Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06620 402 / 5e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 399 / 9e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT1G06650 393 / 2e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59540 383 / 2e-132 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59530 377 / 5e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30840 376 / 8e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06645 367 / 4e-126 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03410 363 / 4e-124 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04350 362 / 4e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G61400 358 / 1e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G073166 [exp] 523 / 0 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 451 / 5e-159 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 406 / 1e-141 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G165400 [exp] 377 / 6e-130 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 366 / 8e-126 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.013G045000 [exp] 321 / 4e-108 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 313 / 5e-105 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 305 / 2e-101 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 284 / 1e-93 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022191 [exp] 449 / 2e-158 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022193 [exp] 435 / 1e-152 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027586 [exp] 428 / 5e-150 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022197 [exp] 426 / 2e-149 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021943 [exp] 421 / 3e-147 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 412 / 7e-144 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001103 [exp] 412 / 2e-143 AT1G06620 427 / 2e-149 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021203 [exp] 410 / 6e-143 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 408 / 3e-142 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 402 / 6e-140 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.010G073232.1 pacid=42797924 polypeptide=Potri.010G073232.1.p locus=Potri.010G073232 ID=Potri.010G073232.1.v4.1 annot-version=v4.1 ATGGCCTCCACACTTGATTCCAGTTCTGATCGAACAAGTGAATTAAAAGCTTTTGATGAAACCAAAGCCGGTGTCAAAGGACTTGTTGATGCTGGAATCA CCAAGGTCCCTTGGATTTTCCATCACCCACCAGATGACTTAGACAAGACTTTGATTGTTGCTACAGATGGCAAGTTCAGATTTCCAATCATAGACCTGGA GGGTGTCCGTAAAGATCCCTTTCAACGCAAGGAGATCGTTGAGAGAGTCCGAGATGCATCAGAGACTTGGGGCTTTTTTGAAGTGGTCAATCATGGGATT CCTGTCAGTGTTCTGGAGGAGATGAAGGATGGGGTATGTAGGTTTTATGAGCAAGATGTTGAGCTGAAAAAAGAATACTTTTCTCGTGATTATACAAGAA AGGTCATCTATAATAGCAATTTTGATTTGTATACTGCATCATCAACTAACTGGAGGGATACTGTTTCTTATATCATGGCTCCTGGTCCTCCCATGCCAGA GGAATTGCCAGCGGCCTGCAGAGATATACTGATGGAATACAGCAAGGCAGTCATGAACTTGGGAAATCTGCTGCTTGAGTTATTATCAGAGGCCCTAGGG TTAAATCCAAACTACTTGAAAGACATTGATTGTGCTAAGGGGCTTGCAGTTCTCTGTCATTACTATCCAGCATGCCCTCAGCCAGAATTAACCTTGAGAG CAACGAAGCACTCTGATAATGACTTCCTCACCGTGCTTCTACAAGATCAAATTGGTGGCCTCCAGATTCTCCACCAGAATCAGTGGGTGGATGTACCTCC CACGCCTGGGGCTTTGGTAATTAATATCGGAGATCTTATGCAGCTTATATCAAACGACAAGTTCATTAGCGTTGAGCACAGGGTGCTGGCGAACTGTAAA GGACCAAGAGTATCTGTAGCATGCTTTTTCAGTACATTTCTTACCCCATCCCCGAGATTCTATGGACCTATGAAAGAGTTGTTATCGGAAGAGAATCTTC CAAAGTACAGGGAAACTACAGTAAGAGACTATTGTGCCCACTACAACGAAAAGGGGCTTGGTAGGACTTCTGCTCTTCTGGATTTCAAGCTCTGA
AA sequence Show only first row Show all	>Potri.010G073232.1 pacid=42797924 polypeptide=Potri.010G073232.1.p locus=Potri.010G073232 ID=Potri.010G073232.1.v4.1 annot-version=v4.1 MASTLDSSSDRTSELKAFDETKAGVKGLVDAGITKVPWIFHHPPDDLDKTLIVATDGKFRFPIIDLEGVRKDPFQRKEIVERVRDASETWGFFEVVNHGI PVSVLEEMKDGVCRFYEQDVELKKEYFSRDYTRKVIYNSNFDLYTASSTNWRDTVSYIMAPGPPMPEELPAACRDILMEYSKAVMNLGNLLLELLSEALG LNPNYLKDIDCAKGLAVLCHYYPACPQPELTLRATKHSDNDFLTVLLQDQIGGLQILHQNQWVDVPPTPGALVINIGDLMQLISNDKFISVEHRVLANCK GPRVSVACFFSTFLTPSPRFYGPMKELLSEENLPKYRETTVRDYCAHYNEKGLGRTSALLDFKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.010G073232 [exp]	0	1
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117001 [exp]	3.00	0.9266
AT4G13010			Oxidoreductase, zinc-binding d...		Potri.001G452600 [exp]	3.46	0.9254
					Potri.019G002400 [exp]	7.48	0.9082
AT5G59100			Subtilisin-like serine endopep...		Potri.010G196700 [exp]	8.83	0.9043
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Potri.010G131200 [exp]	10.00	0.9077
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116900 [exp]	13.41	0.8901
AT5G06720		ATPA2	peroxidase 2 (.1)		Potri.016G058200 [exp]	14.00	0.9022	HPOX14.2
AT1G06840			Leucine-rich repeat protein ki...		Potri.013G159200 [exp]	18.97	0.8962
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Potri.014G113400 [exp]	21.21	0.8892
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Potri.005G148400 [exp]	30.74	0.8538

Compare expression of checked genes

Potri.010G073232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.