Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14455 147 / 2e-46 ATBS14B ,ATBET12 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) AT3G58170 138 / 3e-43 ATBET11, ATBS14A ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G221600 [exp] 139 / 2e-43 AT3G58170 206 / 4e-70 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Potri.002G041500 [exp] 137 / 1e-42 AT3G58170 202 / 7e-69 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Potri.008G164600 [exp] 55 / 7e-11 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041158 [exp] 162 / 2e-52 AT4G14455 164 / 6e-53 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) Lus10033868 [exp] 135 / 1e-41 AT3G58170 187 / 1e-62 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Lus10024876 [exp] 135 / 6e-38 AT3G12770 886 / 0.0 mitochondrial editing factor 22 (.1) Lus10000706 [exp] 122 / 3e-33 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1) Lus10021879 [exp] 103 / 2e-29 AT4G14455 110 / 4e-32 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) Lus10009926 [exp] 60 / 9e-13 AT3G58170 81 / 6e-21 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Lus10014756 [exp] 56 / 9e-10 AT5G11010 440 / 2e-152 Pre-mRNA cleavage complex II protein family (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G074100.1 pacid=42798062 polypeptide=Potri.010G074100.1.p locus=Potri.010G074100 ID=Potri.010G074100.1.v4.1 annot-version=v4.1 ATGAGTTACAGAAGGGAGCATCGAAATTCGAGAACAGCTCTCTTTGATGATGGGCTTGAAGAAGGAGGTCTTAGGCCATCCTCTTCCTTTTCCCACGAAA CCGACGACCATGACAATGATAAGGCTGTCCACACATTGCAAGATAGAGTTCTTTTCCTCAAGAGCTTAACGGGTGATATACATGAGGAAGTGGAGAGTCA AAACCGTTTGCTTGATCGAATGGGCAACAACATGGACACGTCGAGGGGTATAATGTCAGGAACCATGGATCGATTCAGGATGGTATTTGAAAAGAAATCA AGTCGGAGAACATGTGCCCTTGCAGGGTTTTTCATCCTCTCCTTTTTAATTCTGTATTATCTCATTAGGGTCCTTGTATACTTGAAGCACGGTTGA
AA sequence Show only first row Show all	>Potri.010G074100.1 pacid=42798062 polypeptide=Potri.010G074100.1.p locus=Potri.010G074100 ID=Potri.010G074100.1.v4.1 annot-version=v4.1 MSYRREHRNSRTALFDDGLEEGGLRPSSSFSHETDDHDNDKAVHTLQDRVLFLKSLTGDIHEEVESQNRLLDRMGNNMDTSRGIMSGTMDRFRMVFEKKS SRRTCALAGFFILSFLILYYLIRVLVYLKHG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14455		ATBS14B ,ATBET1...	ARABIDOPSIS THALIANA BET1P/SFT...		Potri.010G074100 [exp]	0	1
AT3G09735			S1FA-like DNA-binding protein ...		Potri.016G087400 [exp]	2.82	0.7407	Pt-S1FA3.2
AT5G20700			Protein of unknown function (D...		Potri.006G078300 [exp]	3.00	0.8126
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Potri.013G035500 [exp]	5.47	0.7207
AT1G21780			BTB/POZ domain-containing prot...		Potri.002G082800 [exp]	9.38	0.7132
AT2G40600			appr-1-p processing enzyme fam...		Potri.013G092700 [exp]	9.74	0.7595
AT1G25682			Family of unknown function (DU...		Potri.010G130300 [exp]	11.22	0.6730
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Potri.015G135300 [exp]	13.78	0.7856
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Potri.014G024950 [exp]	15.49	0.7694
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Potri.005G198400 [exp]	21.33	0.7504
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Potri.018G110200 [exp]	21.33	0.6724	ATNAP10.1

Compare expression of checked genes

Potri.010G074100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.