Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	FLO10.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23130 74 / 5e-16 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G37740 73 / 4e-15 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) AT4G17810 71 / 4e-15 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G42410 67 / 2e-13 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) AT5G06070 66 / 7e-13 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G09290 49 / 3e-07 C2H2ZnF TAC1 telomerase activator1 (.1) AT3G53820 48 / 4e-07 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G43540 44 / 8e-06 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT1G24625 45 / 9e-06 C2H2ZnF ZFP7 zinc finger protein 7 (.1) AT1G80730 44 / 2e-05 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G163900 [exp] 199 / 7e-65 AT3G23130 119 / 1e-33 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.016G101400 [exp] 75 / 5e-16 AT2G37740 108 / 3e-27 zinc-finger protein 10 (.1) Potri.001G142900 [exp] 74 / 9e-16 AT4G17810 135 / 1e-39 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G089600 [exp] 74 / 1e-15 AT2G37740 102 / 2e-25 zinc-finger protein 10 (.1) Potri.003G091200 [exp] 74 / 1e-15 AT4G17810 140 / 2e-41 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.008G059000 [exp] 69 / 6e-14 AT5G06070 99 / 2e-24 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G199800 [exp] 67 / 3e-13 AT5G06070 100 / 4e-25 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.002G041700 [exp] 64 / 2e-12 AT2G42410 105 / 3e-28 zinc finger protein 11 (.1) Potri.005G221400 [exp] 59 / 7e-11 AT2G42410 97 / 4e-25 zinc finger protein 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022206 [exp] 73 / 1e-15 AT3G23130 100 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021215 [exp] 74 / 3e-15 AT3G23130 102 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10004578 [exp] 69 / 3e-14 AT4G17810 95 / 6e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10000481 [exp] 69 / 3e-14 AT4G17810 100 / 8e-26 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021490 [exp] 69 / 6e-14 AT2G37740 103 / 1e-25 zinc-finger protein 10 (.1) Lus10010871 [exp] 68 / 2e-13 AT2G37740 103 / 9e-26 zinc-finger protein 10 (.1) Lus10024362 [exp] 67 / 2e-13 AT2G37740 105 / 4e-27 zinc-finger protein 10 (.1) Lus10040083 [exp] 67 / 3e-13 AT4G17810 123 / 8e-35 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10004705 [exp] 66 / 3e-13 AT2G37740 100 / 1e-25 zinc-finger protein 10 (.1) Lus10030967 [exp] 67 / 4e-13 AT4G17810 112 / 1e-30 C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [poplar] [flax] C2H2-zf PF13912 [poplar] [flax] zf-C2H2_6 C2H2-type zinc finger
Representative CDS sequence Show only first row Show all	>Potri.010G074500.1 pacid=42798555 polypeptide=Potri.010G074500.1.p locus=Potri.010G074500 ID=Potri.010G074500.1.v4.1 annot-version=v4.1 ATGGAGAGGAACAGTTTTAGCAGCAACTTGAAAGATCATAGTATTGGCAGTGAAGCGTGCAACAACACTAACAGCAACAAGAAGCTCAGAGATTCATGGA ACCTTAGCAGCTGCCAAAGCTTTGGAGAAGATTATCTTGATAGTCTTTCATGGCCTCCAAGATCGTACACGTGTAGCTTCTGCAGAAGGGAATTTAAATC TGCTCAAGCTCTTGGCGGTCACATGAATGTTCATAGGAGAGATAGAGCCAGGTTAAGAAGGTCACCTCCAAGGGACGCTCAGTGTCCTGTTCCGAACCTT AACCCTAACCCTAGTTTATGTCCTCCATTCACTCGCACATTACCATCCTTGGTGTCTCCTCCTCTTTCTGCACTATCTACACCACCTTTAGCTTCTGAAG TCAAGAAATGGACCATTGATGGTACCCCTCTTGACCCTTCAAGCTCTGAACTTTCTGATTTAACAACAACGGGAACCAGAAAATCCTTCTTCACAACTGA AAACTTTGGTGGTTTCACACAACAAGATGGATTCAAGATCTGGAAGAAGGCTGAGATTGTGAGGTTAGATTTGGAGATTGGTCTTGTTCGTGACTCCAAG GATGAATTGGATTTGGAACTTCGACTGGGATCTCTTAATTAG
AA sequence Show only first row Show all	>Potri.010G074500.1 pacid=42798555 polypeptide=Potri.010G074500.1.p locus=Potri.010G074500 ID=Potri.010G074500.1.v4.1 annot-version=v4.1 MERNSFSSNLKDHSIGSEACNNTNSNKKLRDSWNLSSCQSFGEDYLDSLSWPPRSYTCSFCRREFKSAQALGGHMNVHRRDRARLRRSPPRDAQCPVPNL NPNPSLCPPFTRTLPSLVSPPLSALSTPPLASEVKKWTIDGTPLDPSSSELSDLTTTGTRKSFFTTENFGGFTQQDGFKIWKKAEIVRLDLEIGLVRDSK DELDLELRLGSLN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23130	C2H2ZnF	FLO10, FON1, SU...	SUPERMAN, FLORAL ORGAN NUMBER ...		Potri.010G074500 [exp]	0	1	FLO10.1
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Potri.001G125600 [exp]	12.56	0.5393	GF14.2
AT5G44265			Bifunctional inhibitor/lipid-t...		Potri.002G012300 [exp]	29.15	0.5862
AT1G14200			RING/U-box superfamily protein...		Potri.011G119900 [exp]	34.95	0.5631
					Potri.002G159350 [exp]	39.77	0.5998
					Potri.004G151301 [exp]	49.56	0.5506
AT3G20190			Leucine-rich repeat protein ki...		Potri.014G002700 [exp]	97.54	0.5102
					Potri.011G164750 [exp]	104.71	0.4977
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Potri.015G077700 [exp]	106.00	0.5051
AT4G19110			Protein kinase superfamily pro...		Potri.010G154400 [exp]	133.94	0.4950
					Potri.013G094950 [exp]	138.10	0.5215

Compare expression of checked genes

Potri.010G074500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.