Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55140 67 / 4e-16 ribosomal protein L30 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G225600 [exp] 97 / 6e-28 AT5G55140 154 / 4e-50 ribosomal protein L30 family protein (.1) Potri.014G157400 [exp] 93 / 3e-26 AT5G55140 151 / 5e-49 ribosomal protein L30 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031912 [exp] 82 / 1e-21 AT5G55140 161 / 7e-53 ribosomal protein L30 family protein (.1) Lus10004595 [exp] 79 / 2e-20 AT5G55140 161 / 6e-53 ribosomal protein L30 family protein (.1) Lus10011966 [exp] 78 / 3e-20 AT5G55140 160 / 1e-52 ribosomal protein L30 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G076275.1 pacid=42798866 polypeptide=Potri.010G076275.1.p locus=Potri.010G076275 ID=Potri.010G076275.1.v4.1 annot-version=v4.1 ATGCATTCAATGCTTTCAAAGCCCAAGTTTTATATAACCTTGGTAAGGGGCATTCCAGGAACTAGGAGACTTCACAGGCGTGCCGTAGAGGCATCGCGTC TTGGCAAGTGCAACCAGACTTTCATGCGGTGGAATACTCCCACAGTCAGGGATGATCCAGCAGGGCATTGTGTTCTAATACATTATTTAATTTTCCATCG GGTGAAGAGGTTAGTTGTGGTTGAAATGGAAGAGATGTACAAGGCCCATAAACAAAAATGA
AA sequence Show only first row Show all	>Potri.010G076275.1 pacid=42798866 polypeptide=Potri.010G076275.1.p locus=Potri.010G076275 ID=Potri.010G076275.1.v4.1 annot-version=v4.1 MHSMLSKPKFYITLVRGIPGTRRLHRRAVEASRLGKCNQTFMRWNTPTVRDDPAGHCVLIHYLIFHRVKRLVVVEMEEMYKAHKQK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G55140			ribosomal protein L30 family p...		Potri.010G076275 [exp]	0	1
AT4G22820			A20/AN1-like zinc finger famil...		Potri.012G130000 [exp]	24.45	0.7219
AT5G18590			Galactose oxidase/kelch repeat...		Potri.008G214900 [exp]	35.28	0.6889
AT5G49650		XK2, XK-2	XYLULOSE KINASE 2, xylulose ki...		Potri.019G077600 [exp]	41.56	0.6317
AT1G80940			unknown protein		Potri.003G184925 [exp]	44.09	0.6562
AT3G59490			unknown protein		Potri.017G028900 [exp]	58.02	0.6910
AT3G08505	C3HZnF		zinc finger (CCCH-type/C3HC4-t...		Potri.009G062600 [exp]	67.90	0.6388
AT2G25280			unknown protein		Potri.018G023700 [exp]	74.61	0.6804
AT1G31170		ATSRX	sulfiredoxin (.1.2.3.4)		Potri.015G124601 [exp]	86.44	0.6460
					Potri.002G093800 [exp]	90.42	0.6069
AT5G17990		PAT1, TRP1	PHOSPHORIBOSYLANTHRANILATE TRA...		Potri.012G082700 [exp]	96.60	0.6422

Compare expression of checked genes

Potri.010G076275 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.