Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-MPI7.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04260 120 / 7e-35 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT1G55190 78 / 3e-18 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G08770 75 / 7e-17 PRA1.E prenylated RAB acceptor 1.E (.1) AT2G38360 70 / 6e-15 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT3G13720 69 / 1e-14 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13710 64 / 6e-13 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT5G05380 63 / 2e-12 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT5G01640 63 / 3e-12 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT1G55640 58 / 1e-10 PRA1.G1 prenylated RAB acceptor 1.G1 (.1) AT2G40380 58 / 2e-10 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044000 [exp] 79 / 2e-18 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 74 / 2e-16 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.002G043800 [exp] 70 / 5e-15 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G219100 [exp] 68 / 3e-14 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.019G124100 [exp] 67 / 5e-14 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.003G035200 [exp] 67 / 5e-14 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.006G104400 [exp] 61 / 2e-11 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.010G183300 [exp] 60 / 3e-11 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.016G126400 [exp] 59 / 1e-10 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021886 [exp] 115 / 5e-31 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10041168 [exp] 91 / 2e-22 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10042246 [exp] 79 / 8e-18 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10026404 [exp] 74 / 2e-16 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10034363 [exp] 65 / 6e-13 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10005088 [exp] 64 / 7e-13 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10014747 [exp] 62 / 9e-12 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 61 / 1e-11 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10012224 [exp] 57 / 3e-10 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1) Lus10002853 [exp] 56 / 1e-09 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.010G077700.1 pacid=42796887 polypeptide=Potri.010G077700.1.p locus=Potri.010G077700 ID=Potri.010G077700.1.v4.1 annot-version=v4.1 ATGTCCCAATTCGTGTCTAGCTTCTTCAAAGAAACCACAAAACCCTTAACATCAGGTCGACGTCCATGGTCCGTTTTCCTAGACCTCACCTTACTGAACC TCCCCTCTTCAATCCACGACACTACCACAAGGATAACCCAAAACGTCCTTCATTTCTTGGTTAATTACTCCATAATCCTCTTGATTATCCTCTCCTTATC CCTCTTAAACCATCCCCTGGTGCTAATCGCCTTGTTCATTACTCTAATTGCCTGGCTCTCTCTTTATTTCTCTCGCGAGGAGCCGCTTTGGTTTTTGGGC TATCAAGTGAGTGACTGGGTGGTGTTGGTTGTGCTCTTTGTGGTTGACTTTTTGGTTGTGATTTGGGGTGGGGTTTTTCAGAATGTTGTCGTTGGTGGTG GGATCGCTGTCGTTTTGATGCTTCTGCATGCTGCGTTGAGGAGTACGGATGATCTTGTTGCTGATGATATTGAAACCTCGCCGTATGCCAACTTGCTCTC TGATGATGATGGTGACTATAATGCTCCTCCAACTGGTGGCTTGTAG
AA sequence Show only first row Show all	>Potri.010G077700.1 pacid=42796887 polypeptide=Potri.010G077700.1.p locus=Potri.010G077700 ID=Potri.010G077700.1.v4.1 annot-version=v4.1 MSQFVSSFFKETTKPLTSGRRPWSVFLDLTLLNLPSSIHDTTTRITQNVLHFLVNYSIILLIILSLSLLNHPLVLIALFITLIAWLSLYFSREEPLWFLG YQVSDWVVLVVLFVVDFLVVIWGGVFQNVVVGGGIAVVLMLLHAALRSTDDLVADDIETSPYANLLSDDDGDYNAPPTGGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04260		PRA1.D, MPIP7, ...	PRENYLATED RAB ACCEPTOR 1.D, C...		Potri.010G077700 [exp]	0	1	Pt-MPI7.1
AT3G46580		MBD05, MDB5, MD...	METHYL-CPG-BINDING DOMAIN PROT...		Potri.001G240100 [exp]	1.41	0.8564	MBD905,Pt-MBD5.1
AT1G79590		ATSYP52, SYP52	syntaxin of plants 52 (.1.2)		Potri.006G032800 [exp]	3.46	0.8581
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Potri.012G066700 [exp]	6.92	0.8537
					Potri.003G101700 [exp]	8.48	0.8352
AT3G18650	MADS	AGL103	AGAMOUS-like 103 (.1)		Potri.010G181300 [exp]	13.03	0.8274
AT3G08505	C3HZnF		zinc finger (CCCH-type/C3HC4-t...		Potri.004G134400 [exp]	15.49	0.8050
AT3G26600		ARO4	armadillo repeat only 4 (.1)		Potri.010G045500 [exp]	16.43	0.7595
AT3G46580		MBD05, MDB5, MD...	METHYL-CPG-BINDING DOMAIN PROT...		Potri.009G031100 [exp]	18.33	0.8028	MBD5.2,MBD904
AT4G38250			Transmembrane amino acid trans...		Potri.009G167900 [exp]	20.78	0.8109	PtrANT3
AT5G48655			RING/U-box superfamily protein...		Potri.014G191400 [exp]	23.45	0.7816

Compare expression of checked genes

Potri.010G077700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.