Plant FIBer expression Database

Potri.010G082101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26400 96 / 2e-26 ARD, ATARD3 acireductone dioxygenase 3 (.1)
AT4G14716 94 / 1e-25 SGB3, ATARD1 suppressor of G Beta 3, acireductone dioxygenase 1 (.1)
AT4G14710 94 / 2e-25 ATARD2 RmlC-like cupins superfamily protein (.1.2.3.4.5)
AT5G43850 72 / 4e-17 ATARD4 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G157500
[exp]
94 / 1e-25 AT4G14710 333 / 5e-118 RmlC-like cupins superfamily protein (.1.2.3.4.5)
Potri.008G157400
[exp]
67 / 2e-15 AT5G43850 308 / 2e-108 RmlC-like cupins superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039375
[exp]
91 / 6e-24 AT4G14710 341 / 7e-121 RmlC-like cupins superfamily protein (.1.2.3.4.5)
Lus10006617
[exp]
90 / 1e-23 AT4G14710 342 / 2e-121 RmlC-like cupins superfamily protein (.1.2.3.4.5)
Lus10021902
[exp]
65 / 2e-14 AT5G43850 303 / 1e-106 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03079 ARD ARD/ARD' family
Representative CDS sequence
>Potri.010G082101.1 pacid=42798322 polypeptide=Potri.010G082101.1.p locus=Potri.010G082101 ID=Potri.010G082101.1.v4.1 annot-version=v4.1
ATGATAGTGACGAAGACGAGGCTGCCTCATCACAGGGAGCCCAATGAATTTGTCTTTGGACCAACTTTATGTTGGCGGCTTGATGCTGACAACTATGAAA
CAGATGAAGAGTTGAAGAAGATACGTGAAGCGCGTGGATATTCCTGCGTGGACTTCGGTGAAGTTTTCCCAGAGAAGCTGCCTAATTATGAAGAGAAGAT
CAAAGACTTTTTTGAAGAACATTTTCACACTGATGAGGAGATTCGCTACTGTGGCTGGAAGTGGTTATTTTCATGTTAG
AA sequence
>Potri.010G082101.1 pacid=42798322 polypeptide=Potri.010G082101.1.p locus=Potri.010G082101 ID=Potri.010G082101.1.v4.1 annot-version=v4.1
MIVTKTRLPHHREPNEFVFGPTLCWRLDADNYETDEELKKIREARGYSCVDFGEVFPEKLPNYEEKIKDFFEEHFHTDEEIRYCGWKWLFSC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G26400 ARD, ATARD3 acireductone dioxygenase 3 (.1... Potri.010G082101
[exp]
0 1
AT1G04080 PRP39 Tetratricopeptide repeat (TPR)... Potri.014G192800
[exp]
4.69 0.7678
AT5G15640 Mitochondrial substrate carrie... Potri.008G100100
[exp]
13.63 0.7261
AT3G45100 SETH2 UDP-Glycosyltransferase superf... Potri.016G130000
[exp]
18.43 0.7387
AT1G30970 C2H2ZnF SUF4 suppressor of FRIGIDA4, zinc f... Potri.003G074200
[exp]
18.97 0.7282
AT1G62930 RPF3 RNA processing factor 3, Tetra... Potri.006G271200
[exp]
23.45 0.7443
AT5G38640 NagB/RpiA/CoA transferase-like... Potri.017G111800
[exp]
40.09 0.6930
Potri.003G214400
[exp]
43.26 0.6923
AT5G55100 SWAP (Suppressor-of-White-APri... Potri.001G356800
[exp]
43.63 0.7066
AT5G24970 Protein kinase superfamily pro... Potri.018G014000
[exp]
45.05 0.6826
AT2G03670 CDC48B cell division cycle 48B (.1) Potri.001G128700
[exp]
48.85 0.7206 Pt-CDC48.1

Potri.010G082101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.