Potri.010G084201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G144900 38 / 0.0003 AT4G33790 618 / 0.0 FATTY ACID REDUCTASE 3, ECERIFERUM 4, Jojoba acyl CoA reductase-related male sterility protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G084201.1 pacid=42798406 polypeptide=Potri.010G084201.1.p locus=Potri.010G084201 ID=Potri.010G084201.1.v4.1 annot-version=v4.1
ATGGACAAAAGAAGGAAAAAAGAAGAAGCAGTCAATGATCCTTGCCAGTTGCCACCCTTCCATCGAAGTTGGAAAGAGAACATAAAATTTGTATTATATA
TACCTCATTTTGCAAGCGTTGCGAAGCAGACTTGGCACCAGGAGCTCTTGAAAGAAGATTGCTTCGGTGACTTGTATCAAAAGGCTACAGACAGCGTTCA
AACAGTGACCCACACTTTCACCTTCAGGTATTTTGACCAAAAGGTATTCGCATCTTGCTAG
AA sequence
>Potri.010G084201.1 pacid=42798406 polypeptide=Potri.010G084201.1.p locus=Potri.010G084201 ID=Potri.010G084201.1.v4.1 annot-version=v4.1
MDKRRKKEEAVNDPCQLPPFHRSWKENIKFVLYIPHFASVAKQTWHQELLKEDCFGDLYQKATDSVQTVTHTFTFRYFDQKVFASC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G084201 0 1
AT3G63095 Tetratricopeptide repeat (TPR)... Potri.004G022700 1.41 0.9497
AT3G54450 Major facilitator superfamily ... Potri.001G027100 3.00 0.9186
AT3G05500 Rubber elongation factor prote... Potri.013G017300 3.46 0.8873 SRPP.2
Potri.001G399050 4.24 0.9369
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Potri.004G022800 4.47 0.8241
AT1G78960 ATLUP2 lupeol synthase 2 (.1) Potri.004G015600 4.47 0.8986 Pt-LCOSC2.7
AT1G61820 BGLU46 beta glucosidase 46 (.1.3) Potri.004G019366 7.14 0.8514
AT2G45960 PIP1;2, ATHH2, ... TRANSMEMBRANE PROTEIN A, NAMED... Potri.009G127900 9.16 0.8817
Potri.017G071950 11.48 0.8686
AT1G31490 HXXXD-type acyl-transferase fa... Potri.001G128100 12.64 0.8525

Potri.010G084201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.