Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PBD2.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 366 / 7e-131 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 356 / 4e-127 PBD2 20S proteasome beta subunit D2 (.1.2) AT1G53850 67 / 2e-13 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 66 / 6e-13 PAE2 20S proteasome alpha subunit E2 (.1) AT1G13060 62 / 3e-11 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 61 / 4e-11 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G56450 47 / 2e-06 PBG1 20S proteasome beta subunit G1 (.1) AT3G22110 46 / 4e-06 PAC1 20S proteasome alpha subunit C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G155500 [exp] 410 / 3e-148 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.001G162900 [exp] 64 / 3e-12 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 61 / 4e-11 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.010G058100 [exp] 58 / 3e-10 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.008G177000 [exp] 58 / 4e-10 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.014G069800 [exp] 51 / 8e-08 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 51 / 8e-08 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G037700 [exp] 51 / 1e-07 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1) Potri.006G242000 [exp] 48 / 8e-07 AT1G56450 399 / 1e-142 20S proteasome beta subunit G1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039351 [exp] 378 / 1e-135 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10041194 [exp] 368 / 1e-131 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10021909 [exp] 365 / 1e-130 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1) Lus10006596 [exp] 185 / 7e-61 AT3G22630 168 / 2e-54 20S proteasome beta subunit D1 (.1) Lus10003936 [exp] 64 / 1e-11 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 63 / 2e-11 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10011369 [exp] 56 / 4e-09 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10006426 [exp] 54 / 1e-08 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10036124 [exp] 45 / 1e-05 AT1G56450 426 / 4e-153 20S proteasome beta subunit G1 (.1) Lus10011640 [exp] 45 / 1e-05 AT1G56450 427 / 8e-154 20S proteasome beta subunit G1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.010G084800.1 pacid=42800004 polypeptide=Potri.010G084800.1.p locus=Potri.010G084800 ID=Potri.010G084800.1.v4.1 annot-version=v4.1 ATGGAGTGCGTATTTGGACTGGTAGGTGACGGTTTTGTGATCGTAGCATCAGACACATCTGCCGTTAACAGCATCTTGGTTCATAAAACTAACGAAGACA AGATTATGAAACTCGACTCTCACAAGCTAGTTGCCGCTAGCGGCGAGTCAGGCGACCGAGTTCAATTCACGGAGTATATACAGAAGAACGTGGCTTTGTA TCAGTTTCGTAATGGGATTCCTTTGACCACTGCAGCTGCTGCTAACTTTACTCGTGGAGAGCTCGCTACTGCTTTGAGAAAGAACCCTTACATGGTAAAC ATCCTGCTGGCTGGCTATGACAAAGAGACAGGTCCCTCTCTATACTACATTGACTACATCGCTACCCTTCACAAGGTTGACAGGGGAGCATTTGGTTACG GGTCTTATTTTTGTCTCTCCATGATGGACAGACACTACCACAGTGGCATGTCAGTGGAAGAAGCAGTTGAACTGGTCGATAAATGTATAACGGAGATTCA ATCCAGGTTGGTTGTGGCACCGCCAAACTTTGTGATCAAGATTGTTGATAGGGATGGAGCAAGGGAGTATGCCTGGCGTGAATCTGTCAAGGACACCCCA ACAGCCCAACCTGAGGCTTTGGGAGTTTAA
AA sequence Show only first row Show all	>Potri.010G084800.1 pacid=42800004 polypeptide=Potri.010G084800.1.p locus=Potri.010G084800 ID=Potri.010G084800.1.v4.1 annot-version=v4.1 MECVFGLVGDGFVIVASDTSAVNSILVHKTNEDKIMKLDSHKLVAASGESGDRVQFTEYIQKNVALYQFRNGIPLTTAAAANFTRGELATALRKNPYMVN ILLAGYDKETGPSLYYIDYIATLHKVDRGAFGYGSYFCLSMMDRHYHSGMSVEEAVELVDKCITEIQSRLVVAPPNFVIKIVDRDGAREYAWRESVKDTP TAQPEALGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Potri.010G084800 [exp]	0	1	PBD2.2
AT1G27390		TOM20-2	translocase outer membrane 20-...		Potri.001G054900 [exp]	2.64	0.8221	Pt-TOM20.1
AT5G46160			Ribosomal protein L14p/L23e fa...		Potri.010G022800 [exp]	3.87	0.8172	RPL14.1
AT3G05530		ATS6A.2, RPT5A	regulatory particle triple-A A...		Potri.013G016800 [exp]	4.00	0.8053	RPT5.2
AT5G56280		CSN6A	COP9 signalosome subunit 6A (....		Potri.011G169900 [exp]	5.29	0.7585	Pt-CSN6.1
AT1G76860			Small nuclear ribonucleoprotei...		Potri.005G191600 [exp]	6.00	0.8039
AT3G63000		NPL41	NPL4-like protein 1 (.1)		Potri.014G135590 [exp]	6.32	0.8158
AT4G21105			cytochrome-c oxidases;electron...		Potri.001G460200 [exp]	6.48	0.8091
AT4G24820			26S proteasome, regulatory sub...		Potri.012G093500 [exp]	7.74	0.8000
AT3G02420			unknown protein		Potri.017G110600 [exp]	8.71	0.7753
AT3G25545			unknown protein		Potri.010G134600 [exp]	10.90	0.7810

Compare expression of checked genes

Potri.010G084800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.