Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14805 104 / 7e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 44 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G155300 [exp] 157 / 2e-49 AT4G14805 59 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G212000 [exp] 45 / 1e-05 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 44 / 1e-05 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 43 / 3e-05 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085200 [exp] 43 / 4e-05 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G053700 [exp] 42 / 0.0001 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 42 / 0.0001 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 41 / 0.0002 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010576 [exp] 99 / 2e-25 AT4G14805 87 / 5e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021910 [exp] 88 / 3e-21 AT4G14805 81 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 46 / 3e-06 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014683 [exp] 47 / 4e-06 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032488 [exp] 41 / 0.0002 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042984 [exp] 40 / 0.0003 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022067 [exp] 40 / 0.0003 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 40 / 0.0003 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022066 [exp] 40 / 0.0004 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 39 / 0.0008 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.010G085000.1 pacid=42797731 polypeptide=Potri.010G085000.1.p locus=Potri.010G085000 ID=Potri.010G085000.1.v4.1 annot-version=v4.1 ATGACGATCATCATTTTCCCAGCCGTTTTAATCTCCATGCTCCTCCTCCTCTCCGCTGCTGAACCATCGCCAGCGTCACCACCTGGCTGCAGCGATGAAC TGGTGGCCTTCTCTCCGTGCCTCGGCTACGTCTCGGCACCGCCAAACAGAGTCACAGACACGGCGACTTCTCGGTGCTGCGATGCCTTCTCTAAGGCATT CAATTCCAGTGACGGTAACTGCTTCTGCTACCTAATCAAGCAGCCTCTAATCTTCGGATTCCCATTGGATGAATCCAGAGTGATTGCTTTGCCTTCTGCT TGCTCTCTATCAAGTCCTGTATCTTTGGACTCGCTCTGCTCAGGGTCACCAGCACTGCCCCCTCTCCGAGGCCGGACAGCTTCAATGCCTGGTCCTGATG ATCATCATCCATTAGCACCAAGTTTGCCACCAGAATCTGTTGACGGATCACCCGCAAGCCCAGTTTCACCTCTAGCACCAGCATCGCATTCATCAGCAGA GAAACACAACAGCAACGGCTGGTTTCTACCTGGAGTCCTAACTTCCATTGTAATCTTCAATCTGTACTGTTGCAATCATCGTATGCTTACCGCTTGA
AA sequence Show only first row Show all	>Potri.010G085000.1 pacid=42797731 polypeptide=Potri.010G085000.1.p locus=Potri.010G085000 ID=Potri.010G085000.1.v4.1 annot-version=v4.1 MTIIIFPAVLISMLLLLSAAEPSPASPPGCSDELVAFSPCLGYVSAPPNRVTDTATSRCCDAFSKAFNSSDGNCFCYLIKQPLIFGFPLDESRVIALPSA CSLSSPVSLDSLCSGSPALPPLRGRTASMPGPDDHHPLAPSLPPESVDGSPASPVSPLAPASHSSAEKHNSNGWFLPGVLTSIVIFNLYCCNHRMLTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14805			Bifunctional inhibitor/lipid-t...		Potri.010G085000 [exp]	0	1
AT5G11390		WIT1	WPP domain-interacting protein...		Potri.004G111350 [exp]	3.87	0.9911
					Potri.014G163733 [exp]	6.92	0.9908
AT1G03180			unknown protein		Potri.005G208700 [exp]	8.48	0.9883
AT5G20940			Glycosyl hydrolase family prot...		Potri.009G154032 [exp]	9.79	0.9906
AT2G31690			alpha/beta-Hydrolases superfam...		Potri.014G150700 [exp]	10.19	0.9895
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.006G010800 [exp]	13.03	0.9867
					Potri.003G096375 [exp]	13.49	0.9071
AT4G25120		ATSRS2	ARABIDOPSIS THALIANA SUPPRESSO...		Potri.012G114100 [exp]	13.71	0.9538
AT4G10950			SGNH hydrolase-type esterase s...		Potri.003G141300 [exp]	14.96	0.9838
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Potri.008G009001 [exp]	15.87	0.9809

Compare expression of checked genes

Potri.010G085000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.