Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05450 134 / 4e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48140 117 / 2e-33 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 113 / 3e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 59 / 5e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 59 / 9e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 47 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G58550 47 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 43 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 43 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G155200 [exp] 226 / 3e-75 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G212000 [exp] 148 / 8e-45 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 137 / 2e-40 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 53 / 8e-09 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 52 / 3e-08 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 46 / 4e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 45 / 6e-06 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 44 / 2e-05 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G053700 [exp] 44 / 3e-05 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010575 [exp] 143 / 1e-42 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041196 [exp] 119 / 2e-33 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10021911 [exp] 119 / 2e-33 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014683 [exp] 117 / 1e-31 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 111 / 3e-31 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022067 [exp] 114 / 4e-31 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042613 [exp] 100 / 2e-26 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010572 [exp] 57 / 4e-10 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 57 / 6e-10 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 49 / 3e-07 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.010G085200.1 pacid=42796800 polypeptide=Potri.010G085200.1.p locus=Potri.010G085200 ID=Potri.010G085200.1.v4.1 annot-version=v4.1 ATGGAGCGTTTTGTGCCCTTTTCGCGCATGATTCCGTTTCTGGCTGTAGCTCTGGCAGTCATGATTTTGCCTGTTTATGGCCAGATCAATACTGCATGCA CGGCTTCGGTGCTTGCTACCTTCACACCATGCATGAATTTTCTTACAAATAGTACTGCTGCCAATGGTACTTCACCAACAGCAGGTTGTTGCGGTGCACT TAAGAACCTCACAAGTAATGGGATGGACTGTTTCTGTCTTATTGTAACTGGCAGTGTCCCCTTCAGCATACCAATCAACAGAACTTTAGCCATTTCTCTG CCTCGTGCTTGCAACATGCCTGGTGTCCCAGTTCAATGCAAAGCCACAGGTTCACCAATTCCTGCTCCAGGCCCTGTCACCCTTGGGCCAACTCTCTCAC CGGGAGTTTCTCCATCTGCTAGTCCTGAAGCTCCCGTTGTTCCCGAGCCAACACCATCCACTCTCCCGCCAGTATCTGATACGACACCTCTCCTGACGCC ACCATCATCTACAGGAGATACTGGGGCACCGACATCAACTACTGGGAGTCGCCCAGTTCTAACTCCACCATCAGCATCGGCGCCATCTCATAGCCTTTCG CCATCTCTTCTACTATTTGCAGTAGGATTTGTACTCTTCAAGTGCTACTAG
AA sequence Show only first row Show all	>Potri.010G085200.1 pacid=42796800 polypeptide=Potri.010G085200.1.p locus=Potri.010G085200 ID=Potri.010G085200.1.v4.1 annot-version=v4.1 MERFVPFSRMIPFLAVALAVMILPVYGQINTACTASVLATFTPCMNFLTNSTAANGTSPTAGCCGALKNLTSNGMDCFCLIVTGSVPFSIPINRTLAISL PRACNMPGVPVQCKATGSPIPAPGPVTLGPTLSPGVSPSASPEAPVVPEPTPSTLPPVSDTTPLLTPPSSTGDTGAPTSTTGSRPVLTPPSASAPSHSLS PSLLLFAVGFVLFKCY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05450			Bifunctional inhibitor/lipid-t...		Potri.010G085200 [exp]	0	1
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.010G085400 [exp]	1.00	0.9695
AT1G35910		TPPD	trehalose-6-phosphate phosphat...		Potri.012G001000 [exp]	2.44	0.9616
AT4G05100	MYB	ATMYB74	myb domain protein 74 (.1)		Potri.019G118200 [exp]	2.44	0.9612
AT2G46150			Late embryogenesis abundant (L...		Potri.002G165100 [exp]	5.47	0.9372
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075400 [exp]	6.32	0.9372	BGIT.1
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.005G006800 [exp]	6.92	0.9491
AT5G02070			Protein kinase family protein ...		Potri.005G021300 [exp]	7.48	0.9307
AT4G35160			O-methyltransferase family pro...		Potri.011G059600 [exp]	7.93	0.9320	FOMT8,OOMT2.20
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.013G005800 [exp]	8.12	0.8976
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075600 [exp]	8.83	0.9162

Compare expression of checked genes

Potri.010G085200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.