Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22510 98 / 2e-27 Pre-rRNA-processing protein TSR2, conserved region (.1) AT5G27990 73 / 5e-17 Pre-rRNA-processing protein TSR2, conserved region (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G035000 [exp] 109 / 8e-31 AT5G27990 126 / 1e-36 Pre-rRNA-processing protein TSR2, conserved region (.1) Potri.005G047901 [exp] 105 / 4e-29 AT5G27990 124 / 7e-36 Pre-rRNA-processing protein TSR2, conserved region (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006124 [exp] 120 / 1e-32 AT3G22520 340 / 4e-106 unknown protein Lus10005806 [exp] 101 / 1e-27 AT5G27990 107 / 4e-29 Pre-rRNA-processing protein TSR2, conserved region (.1) Lus10006795 [exp] 93 / 1e-24 AT5G27990 107 / 2e-29 Pre-rRNA-processing protein TSR2, conserved region (.1) Lus10027901 [exp] 70 / 1e-15 AT5G27990 79 / 3e-18 Pre-rRNA-processing protein TSR2, conserved region (.1) Lus10002404 [exp] 68 / 9e-15 AT5G27990 77 / 1e-17 Pre-rRNA-processing protein TSR2, conserved region (.1) Lus10010551 [exp] 53 / 7e-09 AT4G14850 668 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10273 [poplar] [flax] WGG Pre-rRNA-processing protein TSR2
Representative CDS sequence Show only first row Show all	>Potri.010G086800.3 pacid=42796865 polypeptide=Potri.010G086800.3.p locus=Potri.010G086800 ID=Potri.010G086800.3.v4.1 annot-version=v4.1 ATGGAATCCATTGTTAAGAACGGCCATAACAAGGTATCCACTACCTTGAAAAAGCCAGAGGTTGCTGTCTCTCATCTCCGGGAGGGCATTGCGCTGCTTC TTTCTCGATGGAATGGTCTACAAATGGCTGTTCAAAATGAGTGGGGTGGCCACGATTCCCTTCAGAAATCCCACCAGCTAGTTCTTGATATCTTCTCTTG GTTCTCTCAATCTAAAGGAACACTTTATGCTGAGGATTTAGAGAATTTGCTCCACGAAAGTCTGTTGCTTTCTTTCAATACAGAGATTGAGGATGGCAGC ATTGAAGAGGTAGCAGAGCAGCTGATGATAATGCATGAAGAATACTTGAACAGGAATCATTACTCAAAAGGTTCTGCATGA
AA sequence Show only first row Show all	>Potri.010G086800.3 pacid=42796865 polypeptide=Potri.010G086800.3.p locus=Potri.010G086800 ID=Potri.010G086800.3.v4.1 annot-version=v4.1 MESIVKNGHNKVSTTLKKPEVAVSHLREGIALLLSRWNGLQMAVQNEWGGHDSLQKSHQLVLDIFSWFSQSKGTLYAEDLENLLHESLLLSFNTEIEDGS IEEVAEQLMIMHEEYLNRNHYSKGSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22510			Pre-rRNA-processing protein TS...		Potri.010G086800 [exp]	0	1
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Potri.007G018000 [exp]	4.24	0.7639	Pt-TRXH.1,PtrTrxh4
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.004G127200 [exp]	4.79	0.7839
AT1G28510			Optic atrophy 3 protein (OPA3)...		Potri.011G059800 [exp]	9.48	0.7114
AT5G49320			Protein of unknown function (D...		Potri.010G140400 [exp]	14.56	0.7494
AT2G32080		PUR ALPHA-1, PU...	purin-rich alpha 1 (.1.2)		Potri.013G061100 [exp]	16.43	0.7323
AT1G71090			Auxin efflux carrier family pr...		Potri.010G115200 [exp]	18.22	0.6347
AT3G59300			Pentatricopeptide repeat (PPR)...		Potri.014G151700 [exp]	19.05	0.7498
					Potri.009G042350 [exp]	19.28	0.6727
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Potri.005G198800 [exp]	19.36	0.6900	RAB7.1
AT3G14280			unknown protein		Potri.001G163100 [exp]	21.54	0.7063

Compare expression of checked genes

Potri.010G086800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.