Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14890 190 / 5e-63 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT2G27510 95 / 1e-25 ATFD3 ferredoxin 3 (.1) AT1G60950 78 / 6e-19 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT5G10000 74 / 2e-17 ATFD4 ferredoxin 4 (.1) AT1G10960 71 / 4e-16 ATFD1 ferredoxin 1 (.1) AT1G32550 65 / 1e-13 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G153200 [exp] 264 / 2e-92 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.004G202500 [exp] 84 / 5e-21 AT2G27510 164 / 3e-52 ferredoxin 3 (.1) Potri.008G020100 [exp] 80 / 9e-20 AT2G27510 180 / 5e-59 ferredoxin 3 (.1) Potri.001G470700 [exp] 79 / 3e-19 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.009G163800 [exp] 78 / 5e-19 AT2G27510 167 / 7e-54 ferredoxin 3 (.1) Potri.010G239100 [exp] 75 / 1e-17 AT2G27510 175 / 7e-57 ferredoxin 3 (.1) Potri.003G015200 [exp] 66 / 3e-14 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.003G090400 [exp] 64 / 2e-13 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Potri.004G218400 [exp] 63 / 4e-13 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006116 [exp] 219 / 9e-75 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10010557 [exp] 221 / 2e-74 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10004870 [exp] 92 / 4e-24 AT2G27510 165 / 5e-53 ferredoxin 3 (.1) Lus10020616 [exp] 90 / 1e-23 AT2G27510 172 / 9e-56 ferredoxin 3 (.1) Lus10043430 [exp] 83 / 1e-20 AT2G27510 179 / 3e-58 ferredoxin 3 (.1) Lus10034144 [exp] 83 / 1e-20 AT2G27510 179 / 1e-58 ferredoxin 3 (.1) Lus10015462 [exp] 78 / 7e-19 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10001369 [exp] 74 / 4e-17 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10000483 [exp] 60 / 1e-11 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Lus10004576 [exp] 58 / 4e-11 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0486 [poplar] [flax] Fer2 PF00111 [poplar] [flax] Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence Show only first row Show all	>Potri.010G087300.1 pacid=42798345 polypeptide=Potri.010G087300.1.p locus=Potri.010G087300 ID=Potri.010G087300.1.v4.1 annot-version=v4.1 ATGGCAGCCCTTCATTTCACCCCATCTCCTTCCTTCATCCTAACCAGACATAAACTACCCACCGAGGTCTCTTCTTTTAAGCTCCACTACAAAGCTGGCA GATCCTTGAAGACTGTAGTTAGGTCCTACAAAGTGGTGATTGAGCATGAAGGTCAATCCACGGAGCTGGAGGTCGAACCGGATGAGACCATACTATCCAA GGCGTTGGACTCTGGATTGACTGTGCCTCATGATTGCAAACTTGGGGTGTGCATGACTTGCCCAGCAAAGCTAATAAGTGGCTCGGTTGATCAGAGTGAT GGTATGCTCAGTGATGATGTGGTCGAGCGAGGGTATGCACTGCTCTGCGCAGCCTATCCAAGGTCAGATTGTCAAATTAGGGTTATTCCTGAAGAGGAGC TTCTGTCACTGCAACTAGCAACAGCTAATGACTGA
AA sequence Show only first row Show all	>Potri.010G087300.1 pacid=42798345 polypeptide=Potri.010G087300.1.p locus=Potri.010G087300 ID=Potri.010G087300.1.v4.1 annot-version=v4.1 MAALHFTPSPSFILTRHKLPTEVSSFKLHYKAGRSLKTVVRSYKVVIEHEGQSTELEVEPDETILSKALDSGLTVPHDCKLGVCMTCPAKLISGSVDQSD GMLSDDVVERGYALLCAAYPRSDCQIRVIPEEELLSLQLATAND

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14890		FdC2	ferredoxin C 2, 2Fe-2S ferredo...		Potri.010G087300 [exp]	0	1
AT5G04590		SIR	sulfite reductase (.1)		Potri.009G052600 [exp]	1.41	0.9867
AT1G30380		PSAK	photosystem I subunit K (.1)		Potri.018G027600 [exp]	2.23	0.9875	Pt-PSAK.1
AT4G39230			NmrA-like negative transcripti...		Potri.013G104000 [exp]	2.82	0.9821
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Potri.002G145100 [exp]	3.16	0.9850
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Potri.006G144100 [exp]	3.87	0.9858
AT1G74730			Protein of unknown function (D...		Potri.012G070600 [exp]	4.89	0.9851
AT1G67090		RBCS1A	ribulose bisphosphate carboxyl...		Potri.017G114600 [exp]	5.29	0.9838
AT2G06510		ATRPA70A, ATRPA...	ARABIDOPSIS THALIANA RPA70-KDA...		Potri.018G065300 [exp]	6.48	0.9842
AT3G01500		SABP3, ATBCA1, ...	ARABIDOPSIS THALIANA SALICYLIC...		Potri.001G348900 [exp]	6.92	0.9750	CA1.3
AT1G58684			Ribosomal protein S5 family pr...		Potri.001G256800 [exp]	7.74	0.9790

Compare expression of checked genes

Potri.010G087300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.