Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 188 / 4e-62 MLP423 MLP-like protein 423 (.1.2) AT1G70830 104 / 7e-29 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G70840 103 / 2e-28 MLP31 MLP-like protein 31 (.1) AT1G70850 102 / 3e-27 MLP34 MLP-like protein 34 (.1.2.3) AT1G70890 100 / 3e-27 MLP43 MLP-like protein 43 (.1) AT5G28010 95 / 3e-25 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G23130 86 / 8e-22 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70880 86 / 8e-22 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28000 82 / 4e-20 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G35260 78 / 6e-19 MLP165 MLP-like protein 165 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131300 [exp] 86 / 8e-22 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.017G051100 [exp] 85 / 2e-21 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.008G131200 [exp] 84 / 2e-21 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131100 [exp] 81 / 7e-20 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.017G051200 [exp] 77 / 6e-19 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G111000 [exp] 76 / 9e-18 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.008G213100 [exp] 57 / 2e-10 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2) Potri.011G127800 [exp] 57 / 2e-10 ND / Potri.010G000600 [exp] 56 / 3e-10 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030646 [exp] 234 / 2e-80 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2) Lus10030840 [exp] 233 / 8e-80 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2) Lus10010701 [exp] 92 / 8e-24 AT1G24020 80 / 3e-19 MLP-like protein 423 (.1.2) Lus10029185 [exp] 88 / 1e-22 AT1G24020 80 / 2e-19 MLP-like protein 423 (.1.2) Lus10010698 [exp] 84 / 2e-19 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2) Lus10029183 [exp] 79 / 1e-18 AT1G24020 73 / 6e-16 MLP-like protein 423 (.1.2) Lus10029182 [exp] 81 / 2e-18 AT1G24020 88 / 1e-20 MLP-like protein 423 (.1.2) Lus10010700 [exp] 76 / 9e-18 AT1G24020 74 / 4e-17 MLP-like protein 423 (.1.2) Lus10010702 [exp] 76 / 2e-16 AT1G24020 79 / 4e-17 MLP-like protein 423 (.1.2) Lus10029184 [exp] 73 / 1e-15 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF10604 [poplar] [flax] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Potri.010G096000.1 pacid=42799065 polypeptide=Potri.010G096000.1.p locus=Potri.010G096000 ID=Potri.010G096000.1.v4.1 annot-version=v4.1 ATGGCTTCCGGTGGAAAGCTTGAAGTTGATGTTGAGATCAAGTCTGCTGCAAAAAAGTTCTGGGATAACATTAGAGACTCCACAACTCTCTTCCCAAAGG CCTTCCCTGACCAATACAAGAGCATTGAAATACTGGAAGGCGATGGCAAGGCAGCTGGTTCCACTCGCCTCTTCACATATGGTGAAGGTTCTCCGCTTGT GAAGGTGTCGAAAGAGAGGATCGACACTGTAGACGAAGCAAAGAAGGAGGTCTCTTACAGTGTGATCGAGGGTGATCTTCTAAAATACTACAAGAGTTTC AAGGCAACCATAGTTGTTACTCCAAAGGGAGATGGAAGCTTGGTGAAATGGATGTGTGAGTTTGTAAAGGCAAGCGAAGATGTTGAAGTCCCACACGTCA TTAAGGATTTTGTGGTAAAGAACTTCCTGGAGGTGGATGAATTAATTCTCAAGGAGTAG
AA sequence Show only first row Show all	>Potri.010G096000.1 pacid=42799065 polypeptide=Potri.010G096000.1.p locus=Potri.010G096000 ID=Potri.010G096000.1.v4.1 annot-version=v4.1 MASGGKLEVDVEIKSAAKKFWDNIRDSTTLFPKAFPDQYKSIEILEGDGKAAGSTRLFTYGEGSPLVKVSKERIDTVDEAKKEVSYSVIEGDLLKYYKSF KATIVVTPKGDGSLVKWMCEFVKASEDVEVPHVIKDFVVKNFLEVDELILKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.010G096000 [exp]	0	1
AT1G29140			Pollen Ole e 1 allergen and ex...		Potri.011G111300 [exp]	1.00	0.9987
AT3G04080		ATAPY1	apyrase 1 (.1)		Potri.019G031200 [exp]	2.00	0.9973	Pt-APY1.2
AT2G30220			GDSL-like Lipase/Acylhydrolase...		Potri.013G153000 [exp]	2.23	0.9967
AT1G65880		BZO1	benzoyloxyglucosinolate 1 (.1)		Potri.017G138451 [exp]	3.00	0.9972
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G136000 [exp]	3.00	0.9950	Pt-LTP2.2
AT3G24480			Leucine-rich repeat (LRR) fami...		Potri.006G245600 [exp]	5.19	0.9854
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Potri.013G051000 [exp]	5.29	0.9968
AT5G18020			SAUR-like auxin-responsive pro...		Potri.009G126400 [exp]	6.63	0.9941
AT1G55320		AAE18	acyl-activating enzyme 18 (.1....		Potri.001G006600 [exp]	6.70	0.9905
AT1G29450			SAUR-like auxin-responsive pro...		Potri.004G181500 [exp]	6.92	0.9953

Compare expression of checked genes

Potri.010G096000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.