Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46290 553 / 0 Transducin/WD40 repeat-like superfamily protein (.1) AT2G46280 545 / 0 TIF3I1, TRIP-1 TGF-beta receptor interacting protein 1 (.1.2.3) AT1G15470 143 / 5e-40 Transducin/WD40 repeat-like superfamily protein (.1) AT3G15610 130 / 4e-35 Transducin/WD40 repeat-like superfamily protein (.1) AT1G52730 129 / 1e-34 Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G67320 80 / 3e-16 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) AT5G64730 76 / 2e-15 Transducin/WD40 repeat-like superfamily protein (.1) AT1G11160 76 / 5e-15 Transducin/WD40 repeat-like superfamily protein (.1) AT3G49660 71 / 7e-14 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT4G02730 69 / 8e-13 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G141400 [exp] 649 / 0 AT2G46290 553 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.001G174600 [exp] 144 / 3e-40 AT1G52730 577 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.003G059500 [exp] 143 / 7e-40 AT1G52730 573 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.001G306500 [exp] 85 / 1e-18 AT5G64730 489 / 2e-176 Transducin/WD40 repeat-like superfamily protein (.1) Potri.007G050100 [exp] 77 / 1e-15 AT5G67320 645 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) Potri.005G144400 [exp] 76 / 6e-15 AT5G67320 671 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) Potri.019G096900 [exp] 74 / 9e-15 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.007G009500 [exp] 74 / 1e-14 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G148500 [exp] 73 / 1e-14 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021857 [exp] 608 / 0 AT2G46290 549 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10010332 [exp] 607 / 0 AT2G46290 550 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10019450 [exp] 126 / 2e-33 AT3G15610 577 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10043302 [exp] 110 / 9e-28 AT3G15610 502 / 2e-180 Transducin/WD40 repeat-like superfamily protein (.1) Lus10002090 [exp] 78 / 4e-16 AT5G64730 525 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10003855 [exp] 77 / 1e-15 AT5G64730 524 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10021059 [exp] 75 / 1e-14 AT2G41500 706 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1) Lus10004167 [exp] 73 / 4e-14 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1) Lus10012230 [exp] 72 / 5e-14 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10039636 [exp] 72 / 7e-14 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.010G100101.1 pacid=42798423 polypeptide=Potri.010G100101.1.p locus=Potri.010G100101 ID=Potri.010G100101.1.v4.1 annot-version=v4.1 ATGAGACCAATCTTGATGAAAGGGCATGAAAGGCCCTTAACATTCCTAAAATACAACAGGGAAGGAGATCTCTTGTTTTCTTGTGCTAAAGATCATAATC CCACCGTCTGGTTCGCCGATAACGGCGAGCGTTTGGGCACATACCGTGGCCACAACGGAGCCGTTTGGTGTTGCGATGTATCAAGAGATTCGATGCTGCT GATTACTGCTAGTGCGGATCAGTCGGTGAAGCTGTGGAATGTTCAGACTGGAGCACAATTGTTCACATTTAATTTCAATTCACCGGCTCGGTCTGTCGAT TTTTCTGTTGGTGATAAACTTGCTGTTATTACTACCGATCCTTTCATGGGAGTCACTTCTGCCATTAATGTCAAAAGCATCGCAGAAGATCCTTCCCAGC AGAGTGGTGAATCCGTGCTCACCATCACCGGACCTACGGGAAGAATTAACAGAGCTGTTTGGGGGTCCCTCAACAAGACTATCATAAGTGCTGGAGAGGA TTCTGTGGTCCGCATATGGGATTCCGAGACTGGAAAATTGTTGAAAGAGTCAGACCCAGAAGTTGGGCATAAGAAGCCGATAACATCACTCACAAAATCT GCTGATGGTTCCCACTTCCTGACTGGTTCTCTAGATAAATCTGCCAAGCTCTGGGACACCAGAACTTTAACTCTTATCAAGACCTATGCAACAGAACGCC CGGTTAATGCTGTTACAATGTCTCCACTTCTTGATCATGTCGTGCTTGGAGGTGGGCAGGATGCATCATCTGTCACCACAACTGATCACCGTGCTGGGAA GTTCGAAGCCAAATTCTACGACAAGGTTCTTCAAGAAGAAATTGGTGGTGTGAAAGGTCATTTTGGACCTATAAATGCTTTGGCGTTCAACCCTGATGGG AAAAGTTTTTCAAGTGGAGGTGAGGATGGTTATGTCAGGCTGCACCACTTCGATCCAGATTATTTCAACATAAAGATTTAG
AA sequence Show only first row Show all	>Potri.010G100101.1 pacid=42798423 polypeptide=Potri.010G100101.1.p locus=Potri.010G100101 ID=Potri.010G100101.1.v4.1 annot-version=v4.1 MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDVSRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVD FSVGDKLAVITTDPFMGVTSAINVKSIAEDPSQQSGESVLTITGPTGRINRAVWGSLNKTIISAGEDSVVRIWDSETGKLLKESDPEVGHKKPITSLTKS ADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDG KSFSSGGEDGYVRLHHFDPDYFNIKI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46290			Transducin/WD40 repeat-like su...		Potri.010G100101 [exp]	0	1
AT5G23535			KOW domain-containing protein ...		Potri.004G062600 [exp]	3.00	0.9366
AT5G11880			Pyridoxal-dependent decarboxyl...		Potri.004G157500 [exp]	5.19	0.9156
AT4G25740			RNA binding Plectin/S10 domain...		Potri.005G040100 [exp]	6.16	0.9388
AT4G39300			unknown protein		Potri.009G115900 [exp]	8.60	0.8925
AT5G24510			60S acidic ribosomal protein f...		Potri.014G105400 [exp]	15.49	0.9340
AT5G61170			Ribosomal protein S19e family ...		Potri.017G092200 [exp]	18.13	0.9293	Pt-RPS19.2
AT4G14320			Zinc-binding ribosomal protein...		Potri.005G092500 [exp]	18.43	0.9341
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.016G082300 [exp]	19.67	0.9267
AT3G52580			Ribosomal protein S11 family p...		Potri.009G019400 [exp]	20.49	0.9307
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.001G452100 [exp]	20.49	0.8948	TIM13.1

Compare expression of checked genes

Potri.010G100101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.