Potri.010G100400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30050 518 / 0 transducin family protein / WD-40 repeat family protein (.1)
AT3G01340 511 / 0 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT4G02730 70 / 2e-13 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
AT2G26060 67 / 2e-12 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
AT1G64350 62 / 1e-10 SEH1H Transducin/WD40 repeat-like superfamily protein (.1)
AT2G43770 61 / 3e-10 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G11160 54 / 7e-08 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G49660 53 / 9e-08 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
AT3G44530 52 / 3e-07 HIRA homolog of histone chaperone HIRA (.1.2)
AT2G32700 52 / 3e-07 MUM1, LUH MUCILAGE-MODIFIED 1, LEUNIG_homolog (.1.2.3.4.5.6.7)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G068900 596 / 0 AT2G30050 526 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Potri.008G141300 533 / 0 AT2G30050 465 / 2e-167 transducin family protein / WD-40 repeat family protein (.1)
Potri.001G221000 75 / 5e-15 AT2G26060 523 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.003G138300 73 / 2e-14 AT1G64350 457 / 4e-163 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.002G212800 69 / 3e-13 AT2G26060 530 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G051900 64 / 3e-11 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.019G096900 59 / 9e-10 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.004G184900 58 / 3e-09 AT3G44530 1365 / 0.0 homolog of histone chaperone HIRA (.1.2)
Potri.009G144800 58 / 4e-09 AT3G44530 1398 / 0.0 homolog of histone chaperone HIRA (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037571 563 / 0 AT2G30050 523 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Lus10011429 562 / 0 AT2G30050 525 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Lus10001904 77 / 6e-16 AT1G64350 442 / 3e-157 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003896 75 / 5e-15 AT1G64350 434 / 4e-154 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10021365 66 / 4e-12 AT2G26060 482 / 2e-172 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017045 64 / 2e-11 AT2G26060 486 / 5e-174 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10014674 58 / 2e-09 AT4G02730 508 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10042333 57 / 3e-09 AT3G18140 572 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10018458 58 / 5e-09 AT1G11160 668 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10011224 58 / 5e-09 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Potri.010G100400.1 pacid=42799537 polypeptide=Potri.010G100400.1.p locus=Potri.010G100400 ID=Potri.010G100400.1.v4.1 annot-version=v4.1
ATGCCGTCTCAGAAAATTGAAACTGGCCATGAGGACACTGTCCATGATGTTGCAATGGATTATTATGGCAAGCGGATTGCAACTGCATCATCGGATCATT
CAATCAAGATAGTTGGGGTGAACAACAATTCTTCTCAGCATCTTGCAAATCTGACCGGGCACCAAGGCCCAGTTTGGCAAGTAGCTTGGGCTCACCCGAA
ATTTGGCTCGTTGCTTGCTTCATGTTCTTATGACGGGCGAGTCATAATTTGGAAGGAGGGTAATCAGAATGATTGGATCCAAGCACATGTTTTTGACGAT
CACAAATCATCTGTCAATTCCATTGCTTGGGCACCTCATGAACTGGGCCTTTGTTTGGCGTGCGGTTCATCTGATGGGAATATATCTGTTTTTACTGCAC
GAGCTGATGGCAATTGGGACACATCGAGGATTGATCAAGCTCACCCTGCTGGTGTAACTTCTGTTTCATGGGCCCCATCCACGGCACCCGGTGCCCTTGT
TGGTTCTGGTTTGCTTGACCCTGCTCAGAAGCTTTGCTCAGGTGGTTGTGATAATACTGTCAAAGTGTGGAAACTGTATAATGGGAATTGGAAGCTGGAT
TGCTTTCCAGCTCTTAATATGCATGCTGATTGGGTGAGGGATGTTGCTTGGGCACCCAACTTGGGCCTTCCAAAATCTACTATTGCTAGTGCCTCGCAGG
ATGGGAAGGTTATTATATGGACTGTGGCAAAGGAAGGTGATCAATGGGAAGGTAAGGTCTTGCATGATTTCAAGGCTCCTGTTTGGAGGGTCTCGTGGTC
ACTAACTGGAAACATACTGGCTGTTGCTGATGGGAACAGCAATGTAACATTGTGGAAAGAAGCTGTAGATGGGGAGTGGCAACAGGTGACAACTGTTGAT
GCCTAG
AA sequence
>Potri.010G100400.1 pacid=42799537 polypeptide=Potri.010G100400.1.p locus=Potri.010G100400 ID=Potri.010G100400.1.v4.1 annot-version=v4.1
MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIVGVNNNSSQHLANLTGHQGPVWQVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWIQAHVFDD
HKSSVNSIAWAPHELGLCLACGSSDGNISVFTARADGNWDTSRIDQAHPAGVTSVSWAPSTAPGALVGSGLLDPAQKLCSGGCDNTVKVWKLYNGNWKLD
CFPALNMHADWVRDVAWAPNLGLPKSTIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGNSNVTLWKEAVDGEWQQVTTVD
A

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30050 transducin family protein / WD... Potri.010G100400 0 1
AT2G30050 transducin family protein / WD... Potri.015G068900 1.41 0.7305
AT5G05987 PRA1.A2 prenylated RAB acceptor 1.A2 (... Potri.010G198000 1.73 0.7323
AT5G55940 EMB2731 embryo defective 2731, Unchara... Potri.001G370200 9.21 0.7155
AT1G08780 PFD4, PDF4, AIP... PREFOLDIN 4, ABI3-interacting ... Potri.005G054500 12.48 0.7004
AT3G27430 PBB1 N-terminal nucleophile aminohy... Potri.004G066000 12.84 0.7272 Pt-PBB1.2
AT1G13560 AAPT1, ATAAPT1 aminoalcoholphosphotransferase... Potri.010G133800 13.41 0.6624 Pt-AAPT1.1
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Potri.004G153400 14.00 0.6929 Pt-ACT2.2
AT5G09310 unknown protein Potri.005G063100 16.24 0.6682
AT1G02130 ARA5, AtRABD2a,... ARABIDOPSIS THALIANA RAB D2A, ... Potri.001G152800 17.20 0.6817 Pt-RAB1.5
AT1G79010 Alpha-helical ferredoxin (.1) Potri.009G116000 17.54 0.7191

Potri.010G100400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.