Pt-EXGT.3 (Potri.010G102300) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-EXGT.3
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14720 470 / 1e-167 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT2G01850 462 / 9e-165 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT1G32170 359 / 5e-124 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT4G18990 328 / 2e-111 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT1G10550 259 / 3e-85 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT4G13090 246 / 4e-80 XTH2 xyloglucan endotransglucosylase/hydrolase 2 (.1)
AT4G13080 228 / 3e-73 XTH1 xyloglucan endotransglucosylase/hydrolase 1 (.1)
AT3G25050 218 / 2e-69 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT1G11545 210 / 4e-66 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT2G06850 207 / 5e-65 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G138400 598 / 0 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.001G136100 375 / 4e-130 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.003G097300 363 / 2e-125 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.009G163850 322 / 6e-110 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.014G115000 267 / 4e-88 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.002G244200 223 / 5e-71 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Potri.006G122900 198 / 1e-61 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 197 / 3e-61 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.004G021000 197 / 4e-61 AT1G11545 498 / 3e-180 xyloglucan endotransglucosylase/hydrolase 8 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013240 479 / 3e-171 AT2G01850 456 / 2e-162 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Lus10030760 476 / 4e-170 AT1G14720 456 / 3e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10029000 476 / 5e-170 AT1G14720 457 / 1e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10010427 359 / 1e-123 AT1G32170 462 / 5e-164 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Lus10012115 313 / 8e-106 AT1G32170 401 / 9e-141 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Lus10029165 266 / 9e-88 AT1G10550 405 / 5e-143 xyloglucan:xyloglucosyl transferase 33 (.1)
Lus10013000 259 / 5e-85 AT1G10550 397 / 9e-140 xyloglucan:xyloglucosyl transferase 33 (.1)
Lus10041341 212 / 1e-66 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 209 / 8e-66 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 209 / 2e-65 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.010G102300.1 pacid=42796870 polypeptide=Potri.010G102300.1.p locus=Potri.010G102300 ID=Potri.010G102300.1.v4.1 annot-version=v4.1
ATGGCGTGCTCTTATCTTGGTCCTTGTTTTCTCTTAATTTGCTCTCTTCTTGCGCTTTTTGTTTCTGGGTCTCAAATTCAAAGAACTTCATTGCCTATTA
TATCCTTTGATGAAGGATACACCCAACTTTTTGGGGATGATAATCTGGTCATGTACAGAGATGGAAAGAGAGTCCATTTATCTCTAGATGAGAGGACAGG
GTCGGGATTTGTTTCTCAGGACTTATACCTACATGGATACTTCAGTGCTTCTATCAAGTTGCCAGCAGATTATACTGCTGGAGTTGTGGTTGCTTTTTAT
ATGTCAAATGGTGACATATTCGAGAAGAACCATGATGAAATTGACTTCGAGTTCTTGGGTAACATAAGAGGCAAAGATTGGAGGATCCAGACAAACATTT
ATGGCAATGGCAGCACTAGTGCCGGCAGAGAAGAGAGATACAGCCTCTGGTTCGATCCCTCTGATGATTTCCATCAGTATAGCATTCTCTGGACCAATTC
TCAGATCATATTTTACGTGGACAACATTCCAATTAGAGAGGTTAAAAGAACAGAATCTATGGGAGCAGATTTCCCTTCCAAGCCAATGTCTTTGTATGCA
ACGATATGGGATGGGTCTGATTGGGCTACTAATGGAGGCAAATATAGAGTGAATTACAAATACGCCCCTTATGTCGCTGAATTTTCTGACCTTGTTCTGC
ACGGGTGTGCTGTCGATCCTGTTGAGCAGTTTCCAAGATGCGATAATACAGAGAGTTCTCAGGCGATCCCCACCGGTGTCACACCAGTGCAAAGAATTAA
GATGGAGAGCTTTAGGGCCAAGTTTATGACATATTCTTATTGCTATGATCGGGTTCGGTACAGGGCTCCCCCATCAGAGTGTGTGATCAATACCAAAGAA
GCAGACCGACTCAAATCTTACGATCCTGTTACTTTTGGCGGAGGCCGGCGCCACCACGGGAAACGACACCACCATAGTCGGTCAAGTCATGCTGAAGTCA
TTTCCATTTAA
AA sequence
>Potri.010G102300.1 pacid=42796870 polypeptide=Potri.010G102300.1.p locus=Potri.010G102300 ID=Potri.010G102300.1.v4.1 annot-version=v4.1
MACSYLGPCFLLICSLLALFVSGSQIQRTSLPIISFDEGYTQLFGDDNLVMYRDGKRVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFY
MSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSAGREERYSLWFDPSDDFHQYSILWTNSQIIFYVDNIPIREVKRTESMGADFPSKPMSLYA
TIWDGSDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPVEQFPRCDNTESSQAIPTGVTPVQRIKMESFRAKFMTYSYCYDRVRYRAPPSECVINTKE
ADRLKSYDPVTFGGGRRHHGKRHHHSRSSHAEVISI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14720 ATXTH28, EXGT-A... xyloglucan endotransglycosylas... Potri.010G102300 0 1 Pt-EXGT.3
AT3G48530 KING1 SNF1-related protein kinase re... Potri.015G094700 2.00 0.7521
AT1G33055 unknown protein Potri.001G452500 7.21 0.6911
AT1G67560 ATLOX6, LOX6 Arabidopsis thaliana lipoxygen... Potri.008G178000 8.94 0.6802
AT1G23380 HD KNAT6S, KNAT6L,... KNOTTED1-like homeobox gene 6 ... Potri.005G014200 12.56 0.7203
AT1G14920 GRAS RGA2, GAI RESTORATION ON GROWTH ON AMMON... Potri.004G070500 12.60 0.7050
AT5G10860 CBSX3 CBS domain containing protein ... Potri.017G000100 13.49 0.6554
AT1G32090 early-responsive to dehydratio... Potri.003G099800 15.68 0.6882
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Potri.001G298700 22.13 0.6650
AT4G18710 DWF12, UCU1, BI... ULTRACURVATA 1, DWARF 12, BRAS... Potri.004G059000 26.07 0.6444 GSK1.2
AT2G33170 Leucine-rich repeat receptor-l... Potri.003G174900 32.78 0.6895

Potri.010G102300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.