Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68040 92 / 2e-23 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G38100 87 / 3e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT3G44840 86 / 3e-21 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT3G44870 86 / 3e-21 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT3G44860 86 / 5e-21 FAMT farnesoic acid carboxyl-O-methyltransferase (.1) AT1G15125 84 / 1e-20 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G37970 82 / 8e-20 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G38780 81 / 3e-19 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT1G66700 79 / 7e-19 PXMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.3) AT5G37990 79 / 2e-18 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G136300 [exp] 164 / 3e-51 AT1G68040 379 / 7e-131 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.010G104800 [exp] 122 / 6e-35 AT1G68040 328 / 4e-111 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.008G136200 [exp] 117 / 6e-33 AT1G68040 312 / 1e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G016112 [exp] 109 / 7e-30 AT1G68040 319 / 2e-107 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G016102 [exp] 108 / 2e-29 AT1G68040 315 / 6e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.017G122900 [exp] 106 / 1e-28 AT1G15125 295 / 5e-98 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.017G122700 [exp] 105 / 1e-28 AT5G38780 322 / 2e-108 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.017G122950 [exp] 104 / 6e-28 AT1G15125 321 / 4e-108 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.012G049900 [exp] 100 / 1e-26 AT1G15125 309 / 1e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021802 [exp] 83 / 2e-20 AT1G68040 203 / 6e-63 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10032569 [exp] 74 / 6e-17 AT5G55250 400 / 2e-139 IAA carboxylmethyltransferase 1 (.1.2) Lus10043177 [exp] 74 / 9e-17 AT5G55250 532 / 0.0 IAA carboxylmethyltransferase 1 (.1.2) Lus10028500 [exp] 72 / 2e-16 AT5G37990 187 / 6e-57 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10025993 [exp] 71 / 2e-15 AT1G19640 288 / 1e-93 jasmonic acid carboxyl methyltransferase (.1) Lus10036547 [exp] 70 / 3e-15 AT5G66430 243 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036550 [exp] 68 / 1e-14 AT3G11480 249 / 8e-80 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036548 [exp] 67 / 2e-14 AT5G66430 250 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10041380 [exp] 67 / 5e-14 AT4G36470 278 / 4e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10024671 [exp] 61 / 6e-12 AT5G66430 280 / 2e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF03492 [poplar] [flax] Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence Show only first row Show all	>Potri.010G104701.1 pacid=42797774 polypeptide=Potri.010G104701.1.p locus=Potri.010G104701 ID=Potri.010G104701.1.v4.1 annot-version=v4.1 ATGTTTGGTAGGACCATAAGCCTTTTCCATGATCAAAATTTGCTTGAGGCTATCAAGCACAAGTATGGATTGCAATTCCATACCTCCCAAATTCCAGAAT TTCAAGTTTTCTTCAGTGATCAACCAATTAACGATTTTAATACCCTCTTTGACAATCTCCCACAAGAAAGGCAATACTTTGCAGCTGGTGTGCTAGGTTC ATTCTACGGTCAGTTATTTCCTGAGTCCTTTCTCCACTTGGTGCACTGCTCTATTTCACTCCATTATTGGCTGTCTAAGCTGCCAGAACAAGTGTTCGAC AAGAATCCCCCTTAA
AA sequence Show only first row Show all	>Potri.010G104701.1 pacid=42797774 polypeptide=Potri.010G104701.1.p locus=Potri.010G104701 ID=Potri.010G104701.1.v4.1 annot-version=v4.1 MFGRTISLFHDQNLLEAIKHKYGLQFHTSQIPEFQVFFSDQPINDFNTLFDNLPQERQYFAAGVLGSFYGQLFPESFLHLVHCSISLHYWLSKLPEQVFD KNPP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68040			S-adenosyl-L-methionine-depend...		Potri.010G104701 [exp]	0	1
AT1G71250			GDSL-like Lipase/Acylhydrolase...		Potri.019G067600 [exp]	7.41	0.8614
AT1G28590			GDSL-like Lipase/Acylhydrolase...		Potri.013G015200 [exp]	8.77	0.8237
AT5G65207			unknown protein		Potri.007G086000 [exp]	13.07	0.8054
AT1G65352			Putative membrane lipoprotein ...		Potri.005G044333 [exp]	14.42	0.7734
					Potri.005G089900 [exp]	17.86	0.7914
					Potri.006G157801 [exp]	18.49	0.7090
					Potri.018G090050 [exp]	20.19	0.6569
AT5G25940			early nodulin-related (.1)		Potri.004G184000 [exp]	21.07	0.7740
AT4G13550			triglyceride lipases;triglycer...		Potri.008G174300 [exp]	25.45	0.6527
					Potri.011G106900 [exp]	30.00	0.6996

Compare expression of checked genes

Potri.010G104701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.