Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14820 112 / 6e-32 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G01630 64 / 3e-13 Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G75170 53 / 2e-09 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT4G36640 50 / 3e-08 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT4G09160 49 / 2e-07 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) AT1G30690 42 / 2e-05 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT3G51670 42 / 3e-05 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1) AT4G08690 42 / 3e-05 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G22180 39 / 0.0002 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G72160 37 / 0.001 Sec14p-like phosphatidylinositol transfer family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G105400 [exp] 170 / 1e-54 AT1G14820 326 / 1e-113 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.008G135600 [exp] 149 / 3e-46 AT1G14820 323 / 2e-112 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.015G023000 [exp] 104 / 1e-28 AT1G14820 276 / 5e-94 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.003G162100 [exp] 69 / 3e-15 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.017G063966 [exp] 69 / 4e-15 AT1G01630 340 / 2e-118 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.001G068000 [exp] 65 / 1e-13 AT1G01630 361 / 3e-127 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.002G261000 [exp] 57 / 9e-11 AT1G75170 427 / 3e-152 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.004G046501 [exp] 52 / 4e-10 AT1G14820 42 / 7e-06 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.007G025800 [exp] 51 / 2e-08 AT1G75170 408 / 2e-144 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001584 [exp] 130 / 1e-38 AT1G14820 320 / 2e-111 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10003699 [exp] 123 / 4e-36 AT1G14820 316 / 1e-109 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10034577 [exp] 120 / 4e-35 AT1G14820 257 / 3e-87 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10016733 [exp] 69 / 3e-15 AT1G01630 325 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10040252 [exp] 68 / 1e-14 AT1G01630 319 / 8e-111 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10022428 [exp] 67 / 2e-14 AT1G01630 323 / 1e-112 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10021817 [exp] 66 / 3e-14 AT1G14820 164 / 3e-50 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10004684 [exp] 66 / 9e-14 AT1G01630 326 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10016312 [exp] 50 / 4e-08 AT1G75170 387 / 2e-136 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10010804 [exp] 49 / 7e-08 AT1G75170 393 / 7e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0512 [poplar] [flax] CRAL_TRIO PF00650 [poplar] [flax] CRAL_TRIO CRAL/TRIO domain
Representative CDS sequence Show only first row Show all	>Potri.010G105100.2 pacid=42797112 polypeptide=Potri.010G105100.2.p locus=Potri.010G105100 ID=Potri.010G105100.2.v4.1 annot-version=v4.1 ATGAGCAACAAAGCAGAAATCGGATTGCTGGGATCGTTGCCAGTTATGAACGGTGGAAATGGAACATACAGCTATGCCAAAAACTCCACCTTGCAGTCTT ACTATCCAGAGCGTCTGGCAAAGTGCTTCATTTTAAGCATGCCATGGTTCTTTGTTAGTTTTTGGAGGATGATTTCTCGCTTTCTCGGGAAGGGCACGTT GGAAAAGATTGTGATAGTAAACGACGACGAAGAAAGAAAATGTTTTGTAAAGGAGATTGGTGAAGAAGTCTTGCCAGAAGAGCTTGGTGGTCGAGCAACG CTAGTAGCTCTCCAAGATGTGACAGTGCCACCATTGGAGGGTTGA
AA sequence Show only first row Show all	>Potri.010G105100.2 pacid=42797112 polypeptide=Potri.010G105100.2.p locus=Potri.010G105100 ID=Potri.010G105100.2.v4.1 annot-version=v4.1 MSNKAEIGLLGSLPVMNGGNGTYSYAKNSTLQSYYPERLAKCFILSMPWFFVSFWRMISRFLGKGTLEKIVIVNDDEERKCFVKEIGEEVLPEELGGRAT LVALQDVTVPPLEG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14820			Sec14p-like phosphatidylinosit...		Potri.010G105100 [exp]	0	1
AT5G35390			Leucine-rich repeat protein ki...		Potri.006G078600 [exp]	10.95	0.9402
AT1G24030			Protein kinase superfamily pro...		Potri.019G030600 [exp]	20.59	0.9263
AT1G62280		SLAH1	SLAC1 homologue 1 (.1)		Potri.002G227800 [exp]	26.98	0.9294
AT2G30070		ATKUP1, ATKT1P,...	POTASSIUM UPTAKE TRANSPORTER 1...		Potri.007G068200 [exp]	33.61	0.9278
AT4G31980			unknown protein		Potri.003G209832 [exp]	38.10	0.9275
AT1G69550			disease resistance protein (TI...		Potri.005G030365 [exp]	45.16	0.9197
AT5G27550			P-loop containing nucleoside t...		Potri.005G030271 [exp]	46.32	0.9084
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.007G141125 [exp]	46.37	0.9254
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.004G179400 [exp]	49.79	0.9250
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Potri.014G001200 [exp]	57.34	0.9224

Compare expression of checked genes

Potri.010G105100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.