Potri.010G107200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67920 62 / 1e-14 unknown protein
AT1G24600 52 / 1e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G134100 120 / 8e-38 AT1G67920 68 / 8e-17 unknown protein
Potri.012G044001 54 / 2e-11 AT1G67920 44 / 2e-07 unknown protein
Potri.015G034800 47 / 1e-08 AT1G67920 48 / 4e-09 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G107200.1 pacid=42799978 polypeptide=Potri.010G107200.1.p locus=Potri.010G107200 ID=Potri.010G107200.1.v4.1 annot-version=v4.1
ATGGAGAACAACAACAATAGCAGAGGCACGGATGGGGATGGGGATCATGGGTGTGTAGGGTTTCCAGCTCACAGCCAGGTTATAAAGATCAAGCAAGAAT
TCGAAAAAATCAAGCATACATCTCCGCAGCAGCTAGAGAAGAGAGGGATTATAAGATGCAGGATCTATAGGCAGCGATCACGTTCGCCTCTGGGTCTAGC
TGAGAGACCCATCTCAGTAGGCAACTAA
AA sequence
>Potri.010G107200.1 pacid=42799978 polypeptide=Potri.010G107200.1.p locus=Potri.010G107200 ID=Potri.010G107200.1.v4.1 annot-version=v4.1
MENNNNSRGTDGDGDHGCVGFPAHSQVIKIKQEFEKIKHTSPQQLEKRGIIRCRIYRQRSRSPLGLAERPISVGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67920 unknown protein Potri.010G107200 0 1
AT4G36990 HSF AT-HSFB1, ATHSF... ARABIDOPSIS THALIANA HEAT SHOC... Potri.007G043800 7.00 0.7977
AT2G46080 unknown protein Potri.008G085600 7.54 0.8341
AT2G40140 C3HZnF ATSZF2, CZF1, Z... \(SALT-INDUCIBLE ZINC FINGER 2... Potri.012G145800 7.74 0.8229
AT1G35710 Protein kinase family protein ... Potri.002G258400 12.96 0.7978
AT4G02380 SAG21, ATLEA5 Arabidopsis thaliana late embr... Potri.002G203500 15.81 0.8041
AT5G39670 Calcium-binding EF-hand family... Potri.004G122900 17.32 0.8173
AT4G36988 CPuORF49 conserved peptide upstream ope... Potri.007G043850 21.90 0.7738
AT1G27730 C2H2ZnF ZAT10, STZ salt tolerance zinc finger (.1... Potri.014G017300 22.27 0.8109 SCOF.2
AT4G33565 RING/U-box superfamily protein... Potri.017G049300 22.73 0.7777
AT1G09070 (AT)SRC2, (AT)S... soybean gene regulated by cold... Potri.005G026700 26.49 0.7753

Potri.010G107200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.