Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G12646 89 / 2e-21 PLATZ transcription factor family protein (.1) AT1G31040 87 / 4e-21 PLATZ transcription factor family protein (.1) AT3G60670 87 / 5e-21 PLATZ transcription factor family protein (.1) AT5G46710 82 / 4e-19 PLATZ transcription factor family protein (.1) AT4G17900 81 / 5e-19 PLATZ transcription factor family protein (.1.2) AT1G32700 78 / 6e-18 PLATZ transcription factor family protein (.1.2) AT2G01818 73 / 5e-16 PLATZ transcription factor family protein (.1) AT1G43000 73 / 6e-16 PLATZ transcription factor family protein (.1) AT1G21000 70 / 1e-14 PLATZ transcription factor family protein (.1.2) AT1G76590 69 / 2e-14 PLATZ transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G059300 [exp] 93 / 3e-23 AT3G60670 238 / 6e-79 PLATZ transcription factor family protein (.1) Potri.002G144900 [exp] 91 / 1e-22 AT3G60670 250 / 7e-84 PLATZ transcription factor family protein (.1) Potri.001G159200 [exp] 91 / 3e-22 AT1G31040 294 / 3e-101 PLATZ transcription factor family protein (.1) Potri.003G075600 [exp] 90 / 6e-22 AT1G31040 306 / 1e-105 PLATZ transcription factor family protein (.1) Potri.018G116000 [exp] 88 / 3e-21 AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1) Potri.006G060500 [exp] 87 / 6e-21 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1) Potri.019G051200 [exp] 85 / 3e-20 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2) Potri.008G137300 [exp] 83 / 1e-19 AT2G01818 221 / 5e-73 PLATZ transcription factor family protein (.1) Potri.009G003200 [exp] 81 / 3e-19 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009283 [exp] 99 / 2e-25 AT3G60670 249 / 2e-83 PLATZ transcription factor family protein (.1) Lus10015881 [exp] 96 / 3e-24 AT3G60670 251 / 4e-84 PLATZ transcription factor family protein (.1) Lus10008031 [exp] 88 / 4e-21 AT2G12646 294 / 1e-100 PLATZ transcription factor family protein (.1) Lus10013242 [exp] 89 / 6e-21 AT2G01818 213 / 3e-68 PLATZ transcription factor family protein (.1) Lus10008814 [exp] 86 / 2e-20 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1) Lus10038103 [exp] 86 / 4e-20 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1) Lus10039989 [exp] 86 / 5e-20 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1) Lus10030763 [exp] 84 / 2e-19 AT2G01818 202 / 3e-64 PLATZ transcription factor family protein (.1) Lus10020337 [exp] 82 / 6e-19 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2) Lus10030968 [exp] 81 / 1e-18 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [poplar] [flax] zf-B_box B-box zinc finger PF04640 [poplar] [flax] PLATZ PLATZ transcription factor
Representative CDS sequence Show only first row Show all	>Potri.010G107600.2 pacid=42799382 polypeptide=Potri.010G107600.2.p locus=Potri.010G107600 ID=Potri.010G107600.2.v4.1 annot-version=v4.1 ATGGAAAAGGTTGTGGGAATCAAACAACTCCGTGCATCTAAACACGAAGTACGCCTAAAAAACTATCCTGCGGTGCCGCAATGGGTAGTTGTTATGTACA ACACCGTCTTCTTCAGGACATGCATCACTCATCCAGACTCCAGAATGGATCGTTTTTGTGCTGATTGCTATTCTTCTTTGTGCTCAAATTGTCTTCCAGC TCATGCTCGCCATAAGCACGTCAAGATTCGAAGATATATCTATAGCGATGTAATCAATCGGCAAGACTTGTCCAAGCTCTTCAACTGCTCTGGCATACAG ACTTATGTTACAAATAAAGCTAGAGTGCTATTCTTGAAGCAAAGGAACCGTTATCATCGTCACCAACAGCAGCAAATTAATTTCAAGGACTATAGATGCA TCATCTGTCACAGAAGTTTGCAAGATAATTGTTCACACTATTGCAGTATTGAATGCAAGGTTACGGCTATTTATGGAGGCGAGTGTAGGAAAGATCAATA CCGAATTCAACATCTCAAGAGGCGAAAATTAAAGCAATCAAGAAAAGGAGTTCCGCTAAGAGCCCCAATGTTCTAA
AA sequence Show only first row Show all	>Potri.010G107600.2 pacid=42799382 polypeptide=Potri.010G107600.2.p locus=Potri.010G107600 ID=Potri.010G107600.2.v4.1 annot-version=v4.1 MEKVVGIKQLRASKHEVRLKNYPAVPQWVVVMYNTVFFRTCITHPDSRMDRFCADCYSSLCSNCLPAHARHKHVKIRRYIYSDVINRQDLSKLFNCSGIQ TYVTNKARVLFLKQRNRYHRHQQQQINFKDYRCIICHRSLQDNCSHYCSIECKVTAIYGGECRKDQYRIQHLKRRKLKQSRKGVPLRAPMF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G12646			PLATZ transcription factor fam...		Potri.010G107600 [exp]	0	1
AT4G24340			Phosphorylase superfamily prot...		Potri.019G050200 [exp]	8.30	0.9951
					Potri.002G184550 [exp]	14.38	0.9949
AT3G60510			ATP-dependent caseinolytic (Cl...		Potri.001G156900 [exp]	16.91	0.9944
AT5G27660			Trypsin family protein with PD...		Potri.018G001301 [exp]	18.43	0.9839
AT5G11320		YUC4	YUCCA4, Flavin-binding monooxy...		Potri.018G033200 [exp]	18.81	0.9698
AT3G23560		ALF5	ABERRANT LATERAL ROOT FORMATIO...		Potri.011G117200 [exp]	21.97	0.9949
AT1G80100		AHP6	histidine phosphotransfer prot...		Potri.003G032400 [exp]	24.91	0.9949
					Potri.011G073141 [exp]	26.26	0.9949
AT3G23550			MATE efflux family protein (.1...		Potri.011G117400 [exp]	29.18	0.9948
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Potri.019G046201 [exp]	29.94	0.9947

Compare expression of checked genes

Potri.010G107600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.