Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14900 98 / 3e-25 HMGA high mobility group A (.1) AT1G48620 71 / 4e-14 HON5 high mobility group A5 (.1) AT3G18035 66 / 2e-12 HON4 winged-helix DNA-binding transcription factor family protein (.1) AT5G08780 50 / 5e-07 winged-helix DNA-binding transcription factor family protein (.1) AT2G30620 47 / 1e-06 winged-helix DNA-binding transcription factor family protein (.1.2) AT1G49950 42 / 0.0002 MYB ATTRB1, TRB1 telomere repeat binding factor 1 (.1.2.3) AT1G72740 40 / 0.0008 MYB Homeodomain-like/winged-helix DNA-binding family protein (.1.2) AT1G06760 39 / 0.001 winged-helix DNA-binding transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G132400 [exp] 144 / 3e-43 AT1G14900 107 / 4e-29 high mobility group A (.1) Potri.017G129400 [exp] 98 / 2e-25 AT1G14900 102 / 2e-27 high mobility group A (.1) Potri.004G087500 [exp] 92 / 5e-23 AT1G14900 91 / 1e-22 high mobility group A (.1) Potri.012G048500 [exp] 72 / 1e-14 AT1G14900 66 / 5e-12 high mobility group A (.1) Potri.015G040200 [exp] 72 / 1e-14 AT1G48620 99 / 6e-22 high mobility group A5 (.1) Potri.002G199900 [exp] 42 / 0.0001 AT2G30620 84 / 4e-20 winged-helix DNA-binding transcription factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004056 [exp] 71 / 4e-15 AT1G14900 104 / 5e-28 high mobility group A (.1) Lus10002284 [exp] 70 / 9e-15 AT1G14900 108 / 6e-30 high mobility group A (.1) Lus10024594 [exp] 71 / 6e-14 AT3G18035 132 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1) Lus10032231 [exp] 66 / 2e-12 AT1G48620 103 / 2e-23 high mobility group A5 (.1) Lus10022001 [exp] 52 / 5e-08 AT2G30620 115 / 3e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10042541 [exp] 51 / 1e-07 AT2G30620 121 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10005535 [exp] 48 / 1e-06 AT2G30620 124 / 8e-35 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10006561 [exp] 46 / 6e-06 AT2G30620 115 / 1e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10006562 [exp] 45 / 1e-05 AT2G30620 112 / 2e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10005534 [exp] 45 / 1e-05 AT2G30620 116 / 9e-32 winged-helix DNA-binding transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00538 [poplar] [flax] Linker_histone linker histone H1 and H5 family
Representative CDS sequence Show only first row Show all	>Potri.010G109600.1 pacid=42797923 polypeptide=Potri.010G109600.1.p locus=Potri.010G109600 ID=Potri.010G109600.1.v4.1 annot-version=v4.1 ATGTCAATTTCCATGGCTACCACCACTGAAGATTCTAATAACCTCCAGCCTCCTCCTCCAGCAGTAGCTCCACCTCCTCCTCCAGCACTAGCTCCACCCC AACAACAGTCACAGCAACAATCCTCCACTATCCCTCAGTACCCTGAGATGATTATGGCAGCTGTCGAGGCGTTGAACGAGAAAGAAGGGTCAAGCAAGAC ATCAATTTCGAAACAAATTGAGTCAACACACCCCGATCTGCCTCCTGCACACGGCACACTACTTTCTCACCATTTAAACAAGTTGAAGCAGAGTGGTCAG CTGGTCTTGGTCAAGAACAACTACATGAAGCCTGACCCTAACGCTCCTCCAAAGAGAGGTAGAGGTCGCCCTCCCAAGCCTAAGCTTCCAACCCCACCTG GAAGTGTTGCTGGACCTCCCAGGCCACGTGGCCGCCCTCCCAAACCAAGGGATCCTTTCGCACCTGTGGCTTCCCCTAAAAAGAAGACGGCAAGTCCTGG AAGTGGCAGGCCACGCGGTCGTCCACCAAAGAACGCTAATACGCCGGTTCCCGCTGTGAGTTCTGGTGCTGCTCCGCCCAGCGGTGTGCCTAGAGGGAGG GGAAGGCCGCCTAAGGTGAAGCCGGCTGTGGCCCCCGTCGCTGGTTGA
AA sequence Show only first row Show all	>Potri.010G109600.1 pacid=42797923 polypeptide=Potri.010G109600.1.p locus=Potri.010G109600 ID=Potri.010G109600.1.v4.1 annot-version=v4.1 MSISMATTTEDSNNLQPPPPAVAPPPPPALAPPQQQSQQQSSTIPQYPEMIMAAVEALNEKEGSSKTSISKQIESTHPDLPPAHGTLLSHHLNKLKQSGQ LVLVKNNYMKPDPNAPPKRGRGRPPKPKLPTPPGSVAGPPRPRGRPPKPRDPFAPVASPKKKTASPGSGRPRGRPPKNANTPVPAVSSGAAPPSGVPRGR GRPPKVKPAVAPVAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14900		HMGA	high mobility group A (.1)		Potri.010G109600 [exp]	0	1
AT5G65360			Histone superfamily protein (....		Potri.001G016900 [exp]	3.31	0.8744
AT3G02820			zinc knuckle (CCHC-type) famil...		Potri.010G097400 [exp]	4.00	0.8053
AT5G16690		ORC3, ATORC3	origin recognition complex sub...		Potri.013G077200 [exp]	5.29	0.8306
AT3G51740		IMK2	inflorescence meristem recepto...		Potri.016G126300 [exp]	5.91	0.8441	Pt-RHG1.4
AT5G65360			Histone superfamily protein (....		Potri.005G233900 [exp]	6.00	0.8716
AT2G14660			unknown protein		Potri.009G085700 [exp]	6.40	0.7676
AT1G48405			Kinase interacting (KIP1-like)...		Potri.012G038000 [exp]	9.16	0.8489
AT3G27060		ATTSO2, TSO2	TSO MEANING 'UGLY' IN CHINESE ...		Potri.017G063900 [exp]	11.35	0.8671
AT3G25100		CDC45	cell division cycle 45 (.1)		Potri.015G090600 [exp]	11.40	0.8232
AT1G57820		ORTH2, VIM1	VARIANT IN METHYLATION 1, ORTH...		Potri.003G162400 [exp]	12.04	0.7820

Compare expression of checked genes

Potri.010G109600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.