Potri.010G110100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G01590 95 / 9e-25 CRR3 chlororespiratory reduction 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027792 100 / 4e-27 AT2G01590 89 / 1e-22 chlororespiratory reduction 3 (.1)
PFAM info
Representative CDS sequence
>Potri.010G110100.2 pacid=42796994 polypeptide=Potri.010G110100.2.p locus=Potri.010G110100 ID=Potri.010G110100.2.v4.1 annot-version=v4.1
ATGGCTTGCTTATCCTGCCACTCCATAACCAAAACACTTGTAGTATTTGCTTCTCTTCCCAGAAACACAAACTCTCCATCCCCACAATCCAACACTGATC
CTAAGCGTCCTTCACTTCCAGTTCCAGTTCCCACGACAACAAGAAGTACCAGAACCAAAAGCACCACTACTCTACCACTACCAAGAAAGAAAAGTGTCCA
AGACAGGCTACAACAACAGCTCAATCTTATGAATATTGAACGTGTCGTTGGTGCTGGCAGTTATCGTGACTATGAGAAACCCATTGACCAAGAGAAGAAG
GAGAAGAAAAAGAAGAAGAAGATGTCTGGATTTATGGAGGAGGGACCAGTGGAGAAGAAGCTCCGAGAGACTGGAGAGTGGGTTACCACCAAAACTGAAG
GAGGATTTCGTTCCAATGGTAAAAGGATTTTAATGTTCTCTTTTAAGTGGGCTATACCACTTTATATTTTTATGGTCTTTGTGGCTTCTGGAGTTATAAA
GCTACCTTTCAGCTCACAATTTCTTGATGATCTGCTCATGTAA
AA sequence
>Potri.010G110100.2 pacid=42796994 polypeptide=Potri.010G110100.2.p locus=Potri.010G110100 ID=Potri.010G110100.2.v4.1 annot-version=v4.1
MACLSCHSITKTLVVFASLPRNTNSPSPQSNTDPKRPSLPVPVPTTTRSTRTKSTTTLPLPRKKSVQDRLQQQLNLMNIERVVGAGSYRDYEKPIDQEKK
EKKKKKKMSGFMEEGPVEKKLRETGEWVTTKTEGGFRSNGKRILMFSFKWAIPLYIFMVFVASGVIKLPFSSQFLDDLLM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G01590 CRR3 chlororespiratory reduction 3 ... Potri.010G110100 0 1
AT5G65840 Thioredoxin superfamily protei... Potri.014G012100 1.73 0.9871
AT3G46660 UGT76E12 UDP-glucosyl transferase 76E12... Potri.001G245900 3.00 0.9754
AT5G51545 LPA2 low psii accumulation2 (.1) Potri.015G129600 4.24 0.9735
Potri.005G063600 4.58 0.9727
AT3G52380 CP33, PDE322 PIGMENT DEFECTIVE 322, chlorop... Potri.006G202000 4.89 0.9752
AT4G25270 OTP70 organelle transcript processin... Potri.015G128800 7.07 0.9691
AT3G57990 unknown protein Potri.001G145400 7.14 0.9619
AT3G08740 elongation factor P (EF-P) fam... Potri.016G136600 9.74 0.9744
AT1G76760 ATY1, TRX-Y1 thioredoxin Y1 (.1) Potri.005G193400 10.95 0.9699 PtrTrxy1
AT1G52870 Peroxisomal membrane 22 kDa (M... Potri.011G123700 15.19 0.9689

Potri.010G110100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.