Potri.010G110850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23149 37 / 3e-05 CPuORF29 conserved peptide upstream open reading frame 29 (.1)
AT1G70782 35 / 8e-05 CPuORF28 conserved peptide upstream open reading frame 28 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G131550 61 / 8e-15 AT1G23149 36 / 4e-05 conserved peptide upstream open reading frame 29 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G110850.1 pacid=42797362 polypeptide=Potri.010G110850.1.p locus=Potri.010G110850 ID=Potri.010G110850.1.v4.1 annot-version=v4.1
ATGGTGGAAATCTTAAGAAGTAGTAGTAATTACATGCTCTCCCTTTGCCAATCAAGGGCGGGCGTTGTCTCTGTGGCCTCTGCTTTCGCTTTCGGATCTT
GCAAGGAAGGCTGGTACTATCGCTGCATCGGTGTCGACCCGTAA
AA sequence
>Potri.010G110850.1 pacid=42797362 polypeptide=Potri.010G110850.1.p locus=Potri.010G110850 ID=Potri.010G110850.1.v4.1 annot-version=v4.1
MVEILRSSSNYMLSLCQSRAGVVSVASAFAFGSCKEGWYYRCIGVDP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23149 CPuORF29 conserved peptide upstream ope... Potri.010G110850 0 1
AT1G70780 unknown protein Potri.010G110800 1.00 0.9448
AT5G65950 unknown protein Potri.011G144700 11.83 0.8454
Potri.009G034001 12.00 0.9229
AT2G29500 HSP20-like chaperones superfam... Potri.001G254700 14.28 0.9209
AT1G53540 HSP20-like chaperones superfam... Potri.001G238700 18.11 0.9156 Pt-HSP17.13
AT2G32120 HSP70T-2 heat-shock protein 70T-2 (.1.2... Potri.010G088600 21.21 0.9152
AT4G25200 ATHSP23.6-MITO mitochondrion-localized small ... Potri.003G076000 21.90 0.9135
AT1G52560 HSP20-like chaperones superfam... Potri.001G192600 27.65 0.9109
AT1G03070 Bax inhibitor-1 family protein... Potri.002G049000 32.68 0.9084
AT4G13640 GARP UNE16 unfertilized embryo sac 16, Ho... Potri.006G081001 34.19 0.9133

Potri.010G110850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.