Potri.010G112300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14990 203 / 3e-69 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G129900 243 / 9e-85 AT1G14990 210 / 6e-72 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021679 177 / 2e-56 AT1G68560 286 / 1e-89 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Lus10035021 156 / 2e-50 AT1G14990 158 / 5e-51 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G112300.1 pacid=42798811 polypeptide=Potri.010G112300.1.p locus=Potri.010G112300 ID=Potri.010G112300.1.v4.1 annot-version=v4.1
ATGCCGATGCTCTATCATGGGTTAAAAGAAATATCAAAGATTCAAAAGCTTCGCAGAGTCGTTTCTTATACTGGTTTCTATTGCTTTGTTGCTGTCATGA
GCTATGCTTATACAACCAATACAACTAGAGCTGGATATTCTAGAGGTGACCAATTCTATGCAGCTTATCCTGCTGGGACTGAGCTTTTAACTGACGCCAC
CAAGCTATATAAAGCTGCACTTGGAAATTGCTTTGAATCAGAGGAGTGGGGTCCAATTGAGTACTCCATCATGGCCAAGCACTTTGAACGCCAGGGGAAA
TCGCCATATGCATATCATGCACAATATATGGCACACCTCCTTTCTCACGGACAGCTTGATGGAAATGGCTAG
AA sequence
>Potri.010G112300.1 pacid=42798811 polypeptide=Potri.010G112300.1.p locus=Potri.010G112300 ID=Potri.010G112300.1.v4.1 annot-version=v4.1
MPMLYHGLKEISKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGTELLTDATKLYKAALGNCFESEEWGPIEYSIMAKHFERQGK
SPYAYHAQYMAHLLSHGQLDGNG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14990 unknown protein Potri.010G112300 0 1
AT3G19508 unknown protein Potri.001G299200 1.41 0.9156
AT2G20710 Tetratricopeptide repeat (TPR)... Potri.016G063400 2.23 0.9212
AT5G42450 Pentatricopeptide repeat (PPR)... Potri.006G213200 7.74 0.8819
AT3G11500 Small nuclear ribonucleoprotei... Potri.006G211100 8.36 0.8860
AT1G48460 unknown protein Potri.014G038800 9.16 0.9134
AT3G49320 Metal-dependent protein hydrol... Potri.015G007900 9.79 0.8960
AT5G50810 TIM8 translocase inner membrane sub... Potri.012G103400 11.31 0.8533
AT5G63100 S-adenosyl-L-methionine-depend... Potri.015G082432 11.66 0.9111
AT4G26055 unknown protein Potri.010G204200 12.44 0.8700
AT5G54580 RNA-binding (RRM/RBD/RNP motif... Potri.001G409800 12.96 0.8856

Potri.010G112300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.