Plant FIBer expression Database

Potri.010G113100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G129200
[exp]
76 / 2e-18 AT1G23050 50 / 3e-08 hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G113100.1 pacid=42799737 polypeptide=Potri.010G113100.1.p locus=Potri.010G113100 ID=Potri.010G113100.1.v4.1 annot-version=v4.1
ATGGATTTTAACCTATGCCTAATCCTCCCCGCCCTCTTCTTCACATCCATACTTGTCAATCTTCCTAGCTTGACCACGTCCGACAGCGGCGAGTGTCCTT
ATCCTTGTTATCCTCCCCCCACCGGGACTGGTACCCCGATTGTCACAACACCACCGTCTCCGCCATCTCAGTCAGCAGGGACATTTTCACCTCCTTTATA
CCCTTCCCCGACTGGAAATTTACCATACTACTATCCACCACCTTTTGGTAACAACTTTAATGGTCCTCCACCTCCTGATCCTATCTTGCCTTATTTTCCC
TTCTACTACAGGAAGCCTCCTCATCAAGACGATGTTTCTTCGGCAACCAGTCTTCCAAGGTCAACTCTTATGATGGGCACATCTAATATTATTGCTTTTG
CTTTTCTGTATCTTTTTTTTGGCTGTTAA
AA sequence
>Potri.010G113100.1 pacid=42799737 polypeptide=Potri.010G113100.1.p locus=Potri.010G113100 ID=Potri.010G113100.1.v4.1 annot-version=v4.1
MDFNLCLILPALFFTSILVNLPSLTTSDSGECPYPCYPPPTGTGTPIVTTPPSPPSQSAGTFSPPLYPSPTGNLPYYYPPPFGNNFNGPPPPDPILPYFP
FYYRKPPHQDDVSSATSLPRSTLMMGTSNIIAFAFLYLFFGC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G70985 hydroxyproline-rich glycoprote... Potri.010G113100
[exp]
0 1
AT1G32770 NAC NST3, ANAC012, ... SECONDARY WALL-ASSOCIATED NAC ... Potri.001G448400
[exp]
1.00 0.8952
Potri.018G015000
[exp]
3.16 0.8746
AT3G52500 Eukaryotic aspartyl protease f... Potri.006G204700
[exp]
10.24 0.8572
AT1G66810 C3HZnF AtC3H14 Zinc finger C-x8-C-x5-C-x3-H t... Potri.017G119900
[exp]
16.97 0.8719
AT4G20050 QRT3 QUARTET 3, Pectin lyase-like s... Potri.001G159900
[exp]
18.00 0.7983 Pt-QRT3.4
AT2G39840 TOPP4 type one serine/threonine prot... Potri.016G142700
[exp]
19.07 0.8576
AT2G16700 ADF5, ATADF5 actin depolymerizing factor 5 ... Potri.004G173800
[exp]
23.66 0.8666 Pt-ADF5.2
AT5G03110 unknown protein Potri.016G086900
[exp]
23.68 0.8597
AT1G33800 Protein of unknown function (D... Potri.013G102200
[exp]
25.27 0.8659
AT3G13130 unknown protein Potri.001G366500
[exp]
25.33 0.8700

Potri.010G113100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.