Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22990 194 / 9e-65 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 190 / 7e-63 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 187 / 6e-62 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G39700 160 / 4e-51 Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 158 / 2e-50 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G66110 153 / 2e-48 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 141 / 9e-44 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 140 / 2e-43 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 101 / 6e-28 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 100 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G123400 [exp] 207 / 8e-70 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.007G087300 [exp] 186 / 2e-61 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 178 / 2e-58 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 174 / 1e-56 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 171 / 2e-55 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 161 / 2e-51 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 158 / 2e-50 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G003700 [exp] 155 / 4e-49 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 153 / 2e-48 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016708 [exp] 217 / 1e-73 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 216 / 4e-73 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 215 / 6e-73 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 202 / 1e-67 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009115 [exp] 200 / 8e-67 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10032446 [exp] 195 / 1e-64 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 186 / 2e-61 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 186 / 2e-61 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 172 / 5e-56 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 165 / 5e-53 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.010G114600.1 pacid=42796948 polypeptide=Potri.010G114600.1.p locus=Potri.010G114600 ID=Potri.010G114600.1.v4.1 annot-version=v4.1 ATGGGTGCTCTTGACGATCTCTCAGATTACCTCTCAGACTTGTTTACAGTTGCCAGGAAGAAGAGGAAAAGAAAACCAATGCAGACAGTTGATATCAAAG TGAAGATGGATTGTGATGGCTGTGAAAGGAGGGTTAAAAATTCTGTTTCCTCCATGAAGGGTGTTAAATCAGTAGAAGTGAACAGAAAGCAAAGCCGGGT GACAGTCAGCGGGAATGTTGAGCCAAACAAGGTCTTGAAGAAAGTGAAGAGCACAGGAAAGAGGGCTGAGTTTTGGCCATATGTCCCATACAACTTGGTG GCTTATCCTTATGCTGCTCAAGCCTATGATAAGAAAGCACCTGCAGGCTATGTGAAGAATGTGGTTCAGGCACTTCCGAGCCCCAACGCAACAGATGAAA GATTTACATCTATGTTTAGCGATGAGAACCCGAATGCATGTTCCATCATGTAG
AA sequence Show only first row Show all	>Potri.010G114600.1 pacid=42796948 polypeptide=Potri.010G114600.1.p locus=Potri.010G114600 ID=Potri.010G114600.1.v4.1 annot-version=v4.1 MGALDDLSDYLSDLFTVARKKRKRKPMQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVNRKQSRVTVSGNVEPNKVLKKVKSTGKRAEFWPYVPYNLV AYPYAAQAYDKKAPAGYVKNVVQALPSPNATDERFTSMFSDENPNACSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22990		HIPP22	heavy metal associated isopren...		Potri.010G114600 [exp]	0	1
AT3G52850		VSR1;1, GFS1, B...	VACUOLAR SORTING RECEPTOR 1;1,...		Potri.016G137350 [exp]	3.46	0.8478
AT2G30590	WRKY	WRKY21	WRKY DNA-binding protein 21 (....		Potri.003G111900 [exp]	7.00	0.8487
AT5G10290			leucine-rich repeat transmembr...		Potri.005G074200 [exp]	8.12	0.8478
AT1G53440			Leucine-rich repeat transmembr...		Potri.001G386300 [exp]	10.09	0.8315
					Potri.007G026000 [exp]	12.80	0.8406
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Potri.002G122600 [exp]	17.20	0.8257
AT2G41870			Remorin family protein (.1)		Potri.016G054400 [exp]	19.36	0.7966
AT1G43910			P-loop containing nucleoside t...		Potri.007G019600 [exp]	23.23	0.8255
AT5G22460			alpha/beta-Hydrolases superfam...		Potri.004G203700 [exp]	23.66	0.7974
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Potri.014G025700 [exp]	24.33	0.7964	NAC146

Compare expression of checked genes

Potri.010G114600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.