Potri.010G118900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68185 164 / 5e-51 Ubiquitin-like superfamily protein (.1)
AT5G55856 59 / 1e-11 Ubiquitin-like superfamily protein (.1)
AT4G26840 49 / 1e-07 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
AT5G55160 45 / 3e-06 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2)
AT5G55170 45 / 4e-06 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G224700 51 / 1e-08 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
Potri.002G224800 50 / 5e-08 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.014G158300 49 / 6e-08 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.014G190300 45 / 3e-06 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000234 148 / 3e-44 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10034627 148 / 3e-44 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10035259 144 / 2e-42 AT1G68185 156 / 3e-47 Ubiquitin-like superfamily protein (.1)
Lus10043185 48 / 2e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10032560 48 / 2e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10032561 48 / 2e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence
>Potri.010G118900.1 pacid=42799691 polypeptide=Potri.010G118900.1.p locus=Potri.010G118900 ID=Potri.010G118900.1.v4.1 annot-version=v4.1
ATGGCTGATTCCGTTGAAGATCTTGATTCTCTATTTGATTACCGTCGCGTGCAGCCTATCGCAATCCTTGACGAGGACGACGACGACGACGAATATGATA
AGCCACCAGTTCCTTCTCCTAAAAAAAGGAAGATTTCCAAGCATAACGTGGAGATTGTTGGCGGTGATCGTGAAGCAAGCCAAGTGACTAATGACGATGA
GGATTGGCTACTTCCTCCTCCTAAGGACTCCAGTGAGTCCCCGAAGCAGATTGATGAGGACTCAACTATTAAAGAGCTGAGGTTAAGGAAGCAGGAGCTA
AAAGCTTTGACAAGTAAAGAGTGTTTGTTTCAATATCTGGAGTCACCAAACAGACAAAGTGATTCAGTGCAGGCTGATCTGGAGTCTGGGGCTGAGCAAC
CATCAAAGCCTCATCATGAAAGAGCTAAAATAGTTATTTCAATTCAAGACAAGGATGAAGTCAAACAATTTCGTGTGTACAAGGATGAAAAGTTTGAGCG
GCTCTTCAAACGGTATGCTGATAAAGTTAAGCTTGGAATTGAGAGCCTAGTTTTTATGTTTGATGGGGACAAAATCAATCTGACGGCCACCCCTGATAGT
CTTGGAATGGACGATGAGGACATTATTGAAGTGCTTGCAAAGAAAAGCTGA
AA sequence
>Potri.010G118900.1 pacid=42799691 polypeptide=Potri.010G118900.1.p locus=Potri.010G118900 ID=Potri.010G118900.1.v4.1 annot-version=v4.1
MADSVEDLDSLFDYRRVQPIAILDEDDDDDEYDKPPVPSPKKRKISKHNVEIVGGDREASQVTNDDEDWLLPPPKDSSESPKQIDEDSTIKELRLRKQEL
KALTSKECLFQYLESPNRQSDSVQADLESGAEQPSKPHHERAKIVISIQDKDEVKQFRVYKDEKFERLFKRYADKVKLGIESLVFMFDGDKINLTATPDS
LGMDDEDIIEVLAKKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G68185 Ubiquitin-like superfamily pro... Potri.010G118900 0 1
AT5G54130 Calcium-binding endonuclease/e... Potri.014G108200 7.81 0.5848
AT3G60830 ATARP7 actin-related protein 7 (.1) Potri.009G060200 12.84 0.5730 ARP902,Pt-ARP7.2
AT5G12240 unknown protein Potri.001G274400 18.11 0.5707
AT5G56170 LLG1 LORELEI-LIKE-GPI-ANCHORED PROT... Potri.001G471500 35.72 0.5150
AT1G43770 RING/FYVE/PHD zinc finger supe... Potri.005G189400 40.69 0.5340
AT2G14520 CBS domain-containing protein ... Potri.001G288000 70.69 0.4951
AT1G02410 cytochrome c oxidase assembly ... Potri.001G078500 75.94 0.4833
AT2G45140 PVA12 plant VAP homolog 12 (.1) Potri.014G060900 89.77 0.4556 Pt-VAP27.5
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Potri.007G024300 106.01 0.4721
AT5G59160 PPO, TOPP2 PROTOPORPHYRINOGEN OXIDASE, ty... Potri.009G037700 249.07 0.3920 Pt-TOPP1.1

Potri.010G118900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.