Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47485 57 / 3e-11 unknown protein AT3G62650 52 / 4e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G119800 [exp] 96 / 2e-26 AT2G47485 66 / 2e-14 unknown protein Potri.004G095200 [exp] 96 / 4e-26 AT2G47485 58 / 2e-11 unknown protein Potri.004G095150 [exp] 96 / 4e-26 AT2G47485 58 / 2e-11 unknown protein Potri.014G124900 [exp] 54 / 7e-10 AT3G62650 77 / 2e-18 unknown protein Potri.002G200000 [exp] 52 / 2e-09 AT2G47485 106 / 3e-30 unknown protein Potri.012G053400 [exp] 44 / 2e-06 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009157 [exp] 101 / 3e-28 AT2G47485 57 / 6e-11 unknown protein Lus10028487 [exp] 99 / 2e-27 AT2G47485 52 / 4e-09 unknown protein Lus10009156 [exp] 97 / 2e-26 AT2G47485 50 / 2e-08 unknown protein Lus10028488 [exp] 96 / 5e-26 ND 48 / 1e-07 Lus10017613 [exp] 91 / 3e-24 AT3G62650 47 / 2e-07 unknown protein Lus10033571 [exp] 90 / 8e-24 AT2G47485 43 / 9e-06 unknown protein Lus10036328 [exp] 59 / 2e-11 AT2G47485 87 / 2e-22 unknown protein Lus10013471 [exp] 53 / 1e-09 ND / Lus10012561 [exp] 47 / 1e-07 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G119200.1 pacid=42799720 polypeptide=Potri.010G119200.1.p locus=Potri.010G119200 ID=Potri.010G119200.1.v4.1 annot-version=v4.1 ATGCAAGAAAAAATGGAGATCATTTCTAGTGCATGCTATGAGAACGTGAAGAGGTACTGGAGAAGGAACAGATACCAAAGACTCAATGGTGCAAGTAAAA GAAAGCTGAAAATCGCAAGGCTTGGTTCAGGGCGGCGCTGGAAACTAAGAGCAGTCCCTAAGTTGCACATGGAAATTGCTTCACCAATAAAACTTCTGGA AAAGTTTCATGATGCTTATATCGATATGATGCTTCGGTTGGCAACCAACATAGGCAGCTTGAACAACAAAGGCTTCTTTAGGGGGAAGAAGGTTGCCAAA GATCAACATATTTCAATGGTATCTTCTGGTGATGAAGTTGACAGCAGGCTGCTTCTGGAAATTTACAAGAAATTGGCTGCTTCTCGTGACATGAGTGATT TTTGA
AA sequence Show only first row Show all	>Potri.010G119200.1 pacid=42799720 polypeptide=Potri.010G119200.1.p locus=Potri.010G119200 ID=Potri.010G119200.1.v4.1 annot-version=v4.1 MQEKMEIISSACYENVKRYWRRNRYQRLNGASKRKLKIARLGSGRRWKLRAVPKLHMEIASPIKLLEKFHDAYIDMMLRLATNIGSLNNKGFFRGKKVAK DQHISMVSSGDEVDSRLLLEIYKKLAASRDMSDF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47485			unknown protein		Potri.010G119200 [exp]	0	1
AT4G33550			Bifunctional inhibitor/lipid-t...		Potri.009G048800 [exp]	10.95	0.5536
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	16.27	0.5489
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	17.83	0.5489
					Potri.019G108100 [exp]	26.83	0.4958
AT3G02100			UDP-Glycosyltransferase superf...		Potri.010G084900 [exp]	28.84	0.5085
AT1G43730			RNA-directed DNA polymerase (r...		Potri.004G000150 [exp]	36.83	0.4699
AT5G13620			unknown protein		Potri.008G045000 [exp]	38.41	0.4910
AT4G38140			RING/U-box superfamily protein...		Potri.009G170460 [exp]	38.49	0.4864
					Potri.001G217950 [exp]	44.09	0.5139
AT5G26330			Cupredoxin superfamily protein...		Potri.006G259000 [exp]	49.95	0.4536

Compare expression of checked genes

Potri.010G119200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.