Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01200 203 / 9e-67 AUX_IAA IAA32, MEE10 maternal effect embryo arrest 10, indole-3-acetic acid inducible 32 (.1.2) AT1G15050 174 / 2e-55 AUX_IAA IAA34 indole-3-acetic acid inducible 34 (.1) AT2G33310 99 / 2e-25 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G04550 92 / 6e-23 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT1G51950 75 / 2e-16 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1) AT4G28640 74 / 5e-16 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT1G52830 72 / 1e-15 AUX_IAA SHY1, IAA6 SHORT HYPOCOTYL 1, indole-3-acetic acid 6 (.1) AT3G16500 72 / 2e-15 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) AT3G62100 70 / 3e-15 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT2G46990 68 / 2e-14 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G065200 [exp] 88 / 7e-21 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.008G172400 [exp] 87 / 2e-20 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.002G256600 [exp] 85 / 7e-20 AT4G28640 191 / 6e-60 indole-3-acetic acid inducible 11 (.1.2.3) Potri.006G161400 [exp] 79 / 2e-17 AT4G29080 293 / 2e-98 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.002G186400 [exp] 76 / 3e-17 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.014G111700 [exp] 72 / 6e-16 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.002G108000 [exp] 75 / 8e-16 AT5G65670 355 / 4e-122 indole-3-acetic acid inducible 9 (.1.2) Potri.001G177500 [exp] 71 / 2e-15 AT3G15540 224 / 4e-75 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) Potri.001G190300 [exp] 72 / 4e-15 AT3G16500 235 / 3e-76 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014464 [exp] 92 / 4e-22 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 89 / 4e-21 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10034962 [exp] 86 / 4e-20 AT4G29080 289 / 4e-97 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10022868 [exp] 82 / 8e-19 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10012984 [exp] 81 / 3e-18 AT4G29080 280 / 8e-94 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10028222 [exp] 74 / 6e-16 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10039488 [exp] 72 / 8e-16 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 72 / 1e-15 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10042929 [exp] 74 / 2e-15 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 72 / 5e-15 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.010G119900.1 pacid=42797020 polypeptide=Potri.010G119900.1.p locus=Potri.010G119900 ID=Potri.010G119900.1.v4.1 annot-version=v4.1 ATGGATTCTAATGCATCAGGCTTCCTTCTAAACCCTCCAGCTCTTCACTCTACTTACTATCAGCCTAGGGAAGATGATGGTATTATTGATCTGGGTCTCA GTCTCAGAACTTTGAAGCCTGAGGCTTATCATCCATCTGGACATCTGGTAGGCCTGGAGGGATATGGTGACCTGATGGACTGGCCTCGGGCAAACTCACC ACTAAAACACTCCACTTCAAGCTACATTAGATTTACCCCACAAGATTGTGACGAGGAGGCAGAGGGAGTTCAGAGCAAAGACAGGTGGGCTTATGTGAAG GTAAACATGGATGGGGTGATTGTTGGTAGGAAAATATGCATGCTAGATCATGGTGGTTACTCAAGCCTCGCACTTCAGCTCGAAGACATGTTTGGAAGAC AATCTGCATCTGGGTTAAGGCTGTTCCAAGCAGGTTCTGAATTCTGCCTGTTCTATAAGGACAGAGAGGAGAATTGGAGAACCGTTGGTGATGTTCCTTG GAAGGAGTTTGTAGAAAGCGTCAAGCGGCTGAGGATTGCACGAAAAAGCGAACCTCTTCTTCCATATTCACCGGCCTTCTCCTGA
AA sequence Show only first row Show all	>Potri.010G119900.1 pacid=42797020 polypeptide=Potri.010G119900.1.p locus=Potri.010G119900 ID=Potri.010G119900.1.v4.1 annot-version=v4.1 MDSNASGFLLNPPALHSTYYQPREDDGIIDLGLSLRTLKPEAYHPSGHLVGLEGYGDLMDWPRANSPLKHSTSSYIRFTPQDCDEEAEGVQSKDRWAYVK VNMDGVIVGRKICMLDHGGYSSLALQLEDMFGRQSASGLRLFQAGSEFCLFYKDREENWRTVGDVPWKEFVESVKRLRIARKSEPLLPYSPAFS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01200	AUX_IAA	IAA32, MEE10	maternal effect embryo arrest ...		Potri.010G119900 [exp]	0	1
AT1G53035			unknown protein		Potri.013G130100 [exp]	15.06	0.8283
AT3G28455		CLE25	CLAVATA3/ESR-RELATED 25 (.1)		Potri.014G021250 [exp]	18.43	0.8197
AT2G41990			unknown protein		Potri.009G140600 [exp]	18.76	0.7920
AT1G25520			Uncharacterized protein family...		Potri.019G116100 [exp]	23.74	0.8104
					Potri.011G102400 [exp]	27.05	0.8162
AT2G20515			unknown protein		Potri.002G038200 [exp]	31.93	0.7906
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Potri.002G043800 [exp]	35.98	0.8095
AT3G20395			RING/U-box superfamily protein...		Potri.001G435800 [exp]	38.88	0.8022
					Potri.013G041350 [exp]	42.04	0.7683
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.017G071000 [exp]	44.35	0.8058

Compare expression of checked genes

Potri.010G119900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.