Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68300 115 / 4e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 114 / 3e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 112 / 1e-31 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 102 / 1e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G25930 97 / 8e-26 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 93 / 3e-24 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 90 / 5e-23 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 78 / 2e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 74 / 7e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 66 / 6e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G121800 [exp] 173 / 6e-56 AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 170 / 9e-55 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 168 / 9e-54 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G112300 [exp] 158 / 9e-50 AT1G68300 113 / 3e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123300 [exp] 149 / 3e-46 AT3G25930 104 / 5e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 121 / 5e-35 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.016G064000 [exp] 121 / 6e-35 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G193800 [exp] 109 / 1e-30 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 108 / 2e-30 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034337 [exp] 165 / 1e-52 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 162 / 1e-51 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 105 / 3e-28 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 102 / 9e-28 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 100 / 8e-27 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 97 / 2e-25 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 101 / 4e-25 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10029310 [exp] 94 / 2e-24 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10014545 [exp] 74 / 6e-17 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10032142 [exp] 74 / 7e-17 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.010G123400.1 pacid=42798098 polypeptide=Potri.010G123400.1.p locus=Potri.010G123400 ID=Potri.010G123400.1.v4.1 annot-version=v4.1 ATGGCGGAGCACGTGACGGAAAATGGAGGGGTACCACTTGAGAGGAAAGTGATGGTTGCCGTTGATGATGGTGAGTATAGCCACTATGCTCTCATGTGGG TACTTGACAATCTTGAGGAATCTATCACTAAATCACCTCTAGTTATCTTCACCGCACAGCCTCCTCCCAGCAATAACCATTCTTTTACTGCCGCTGCTCT CAGTTCTGCTCGCATGTACTGCTCGGTTTCAGCCAATCCGGAGTATACTTACACTATCCAAGACCAGAATAAGAAGATCGCGTTTGCTTTGCTGGAGAAA GCTAAAGAAATTTGTGCTGGTCGAGGAGTTGATGCTGAGACATTAACAGAGGTGGGTGATCCTCAAACAGCCATATGCGATGCAGTTCAAAGGCTCAATA TTAGCCTGCTTGTTTTAGGGGAGCGCGGCATTGGCAAAATCAAAAGAGCTATCCAAGGAAGTGTGAGCAGTTACTGTCTTCACAATGCAAAGTGCCCCGT TCTGGTAGTGAAGAAACCTTAA
AA sequence Show only first row Show all	>Potri.010G123400.1 pacid=42798098 polypeptide=Potri.010G123400.1.p locus=Potri.010G123400 ID=Potri.010G123400.1.v4.1 annot-version=v4.1 MAEHVTENGGVPLERKVMVAVDDGEYSHYALMWVLDNLEESITKSPLVIFTAQPPPSNNHSFTAAALSSARMYCSVSANPEYTYTIQDQNKKIAFALLEK AKEICAGRGVDAETLTEVGDPQTAICDAVQRLNISLLVLGERGIGKIKRAIQGSVSSYCLHNAKCPVLVVKKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68300			Adenine nucleotide alpha hydro...		Potri.010G123400 [exp]	0	1
AT1G06730			pfkB-like carbohydrate kinase ...		Potri.002G042700 [exp]	2.64	0.8959
					Potri.014G144550 [exp]	2.64	0.8470
AT2G38550			Transmembrane proteins 14C (.1...		Potri.016G137200 [exp]	4.00	0.8214
AT1G01360		PYL9, RCAR1	PYRABACTIN RESISTANCE 1-LIKE 9...		Potri.002G169400 [exp]	4.47	0.8545
AT2G34470		PSKF109, UREG	urease accessory protein G (.1...		Potri.002G243700 [exp]	5.65	0.8696	Pt-EU3.1
AT4G38640			Plasma-membrane choline transp...		Potri.009G132900 [exp]	7.21	0.8299
					Potri.003G018400 [exp]	9.48	0.8531
AT4G02340			alpha/beta-Hydrolases superfam...		Potri.013G134900 [exp]	10.39	0.8100
AT2G47710			Adenine nucleotide alpha hydro...		Potri.002G205275 [exp]	10.67	0.8500
AT4G12680			unknown protein		Potri.007G035400 [exp]	11.48	0.8019

Compare expression of checked genes

Potri.010G123400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.