Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13410 121 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G37570 110 / 1e-28 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G74630 104 / 3e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G14470 103 / 6e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G04840 103 / 6e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 102 / 1e-25 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G29230 101 / 4e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G08305 97 / 5e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G45350 97 / 1e-23 CRR4 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18840 94 / 8e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G121400 [exp] 272 / 8e-90 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G258766 [exp] 129 / 4e-35 AT1G06150 705 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Potri.003G087100 [exp] 115 / 4e-30 AT3G29230 368 / 1e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G140400 [exp] 103 / 3e-26 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G316500 [exp] 103 / 5e-26 AT1G04840 728 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G035900 [exp] 102 / 2e-25 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G207500 [exp] 101 / 2e-25 AT5G37570 602 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.017G086100 [exp] 100 / 3e-25 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G046200 [exp] 99 / 1e-24 AT2G44880 676 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021069 [exp] 216 / 3e-68 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021068 [exp] 216 / 3e-68 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017243 [exp] 212 / 7e-67 AT1G13410 539 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039974 [exp] 108 / 6e-28 AT1G06150 612 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10027455 [exp] 108 / 9e-28 AT3G29230 324 / 4e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010183 [exp] 106 / 4e-27 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017386 [exp] 104 / 7e-27 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008825 [exp] 105 / 9e-27 AT1G06150 614 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10029793 [exp] 105 / 1e-26 AT1G04840 756 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10020743 [exp] 105 / 2e-26 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.010G123901.1 pacid=42798835 polypeptide=Potri.010G123901.1.p locus=Potri.010G123901 ID=Potri.010G123901.1.v4.1 annot-version=v4.1 ATGAAGGGACTGAATGTCTTGCCTAATTGCTTAACTTTTCCACTTGTTCTTAAATCGTGTGTCAAGATTAATGCATTGAAAGAAGGTGAAGAGTTGCTTT GTTTTGTGATTAAAAGTGGATTTAGAGCGAACACTTTTGTGGCTGCTACGTTGATCGATATGCAAGCTAGTGGAGAAGCAATCGAAGCTGCTTATAGGGT GTTTGGTGAGCTGATAGAGAGGAATTTAATTGCCTGCACTACAATGATTAATGGCAACATTCCTTGTTGTGATTTAGTAACTGCGCGTCGCCTTTTTGAC TTGGCGCCCGAGCGGGATATTGTGTTGTGGAATACTATGATTTCAGGTTATATTGAGGCTTGGGATATAGGAAGAGCGCAGGAGCTTTTTAATAAGATGC CAAACAAGGATGTTATGTCTTGGAAAACAGTTTTGAATGGTTATGCTAGCAATGGGGCTGGCACAGCCTGTGAGGATTGTTTGAAGAGTTGCCAGAAAGG AACGTTTTTTGTTGAATGA
AA sequence Show only first row Show all	>Potri.010G123901.1 pacid=42798835 polypeptide=Potri.010G123901.1.p locus=Potri.010G123901 ID=Potri.010G123901.1.v4.1 annot-version=v4.1 MKGLNVLPNCLTFPLVLKSCVKINALKEGEELLCFVIKSGFRANTFVAATLIDMQASGEAIEAAYRVFGELIERNLIACTTMINGNIPCCDLVTARRLFD LAPERDIVLWNTMISGYIEAWDIGRAQELFNKMPNKDVMSWKTVLNGYASNGAGTACEDCLKSCQKGTFFVE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13410			Tetratricopeptide repeat (TPR)...		Potri.010G123901 [exp]	0	1
AT3G05950			RmlC-like cupins superfamily p...		Potri.011G163200 [exp]	7.07	0.8001	Pt-GER2.29
AT1G64160			Disease resistance-responsive ...		Potri.013G142602 [exp]	34.20	0.7593
AT3G05950			RmlC-like cupins superfamily p...		Potri.011G162932 [exp]	34.64	0.7533
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.009G078400 [exp]	43.63	0.7466	UF3.3
AT1G64160			Disease resistance-responsive ...		Potri.013G142501 [exp]	51.96	0.7523
AT1G64160			Disease resistance-responsive ...		Potri.001G096680 [exp]	55.45	0.7470
AT1G64160			Disease resistance-responsive ...		Potri.001G096800 [exp]	58.51	0.7440	Pt-DRR206.2
AT1G67490		KNOPF, KNF, GCS...	KNOPF, glucosidase 1 (.1.2)		Potri.010G059000 [exp]	60.86	0.6777	Pt-GCS1.3
AT1G78570		ATRHM1, RHM1, R...	REPRESSOR OF LRX1 1, ARABIDOPS...		Potri.001G383500 [exp]	61.96	0.7557
AT2G07560		AHA6	H\(+\)-ATPase 6, H\(+\)-ATPase...		Potri.001G048300 [exp]	78.46	0.7017	Pt-HA1.2

Compare expression of checked genes

Potri.010G123901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.