Potri.010G124100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G25420 71 / 2e-15 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT4G35730 57 / 1e-10 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 56 / 3e-10 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 49 / 1e-07 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 45 / 2e-06 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G121300 89 / 2e-22 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.013G117100 58 / 1e-10 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 55 / 1e-09 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 54 / 2e-09 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.006G149800 54 / 3e-09 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034330 75 / 9e-17 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10041442 66 / 6e-14 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10028724 57 / 3e-10 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10006061 57 / 3e-10 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028383 56 / 7e-10 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041836 56 / 8e-10 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10040542 48 / 3e-07 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10000978 47 / 5e-07 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Potri.010G124100.2 pacid=42799449 polypeptide=Potri.010G124100.2.p locus=Potri.010G124100 ID=Potri.010G124100.2.v4.1 annot-version=v4.1
ATGCGCAAGGAGATTGCGCAATTTCTTCAGGCTGGACAAGAAGCAATGGCTCGAATTCGAGTGGAACATGTAACGAGGAAAAAGAATATATGGGCTGCAT
ATGAGATATTGGAGCTGGGTGGATCAAAGCAGATTGTGGCTGAAGCCACACTTCCTCAAGCTCCTACCAAACAGAGCTCTCCTCTATCACCACTTTCCAA
TGGGGTCCATCGTACCATAAATATGGATAGCAAACAAGGATCTCATCATCTTCAAGCTTCTGGCACTGTGAGCAATATGCCCCAGCGTGCAGCTTTTGCT
GCCAGCGCAGCTGGCGAGCTTGTAAATGTTAAATTTGGCTCATTTAGGTTAGGTGAAGGCAAGTCATAG
AA sequence
>Potri.010G124100.2 pacid=42799449 polypeptide=Potri.010G124100.2.p locus=Potri.010G124100 ID=Potri.010G124100.2.v4.1 annot-version=v4.1
MRKEIAQFLQAGQEAMARIRVEHVTRKKNIWAAYEILELGGSKQIVAEATLPQAPTKQSSPLSPLSNGVHRTINMDSKQGSHHLQASGTVSNMPQRAAFA
ASAAGELVNVKFGSFRLGEGKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G25420 Regulator of Vps4 activity in ... Potri.010G124100 0 1
AT4G10780 LRR and NB-ARC domains-contain... Potri.018G145568 2.23 0.8726
AT1G78060 Glycosyl hydrolase family prot... Potri.005G168400 4.24 0.8692
AT1G32090 early-responsive to dehydratio... Potri.003G099800 8.66 0.7789
AT3G10120 unknown protein Potri.006G213100 8.94 0.7858
AT5G46460 Pentatricopeptide repeat (PPR)... Potri.001G267100 9.00 0.7947
AT2G31130 unknown protein Potri.004G055300 11.35 0.8258
AT5G44950 F-box/RNI-like/FBD-like domain... Potri.012G099400 11.95 0.7904
AT4G27680 P-loop containing nucleoside t... Potri.012G025351 16.58 0.8118
AT2G33020 AtRLP24 receptor like protein 24 (.1) Potri.011G141100 16.97 0.7855
AT4G23010 ATUTR2, UTR2 UDP-galactose transporter 2 (.... Potri.003G121000 18.33 0.8026

Potri.010G124100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.