Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68585 92 / 3e-25 unknown protein AT2G35730 40 / 6e-05 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G119300 [exp] 177 / 4e-59 AT1G68585 97 / 3e-27 unknown protein Potri.015G053600 [exp] 62 / 1e-13 AT1G68585 56 / 3e-11 unknown protein Potri.003G110500 [exp] 50 / 6e-09 AT2G35730 70 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G234700 [exp] 37 / 0.001 AT2G37390 114 / 2e-30 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035025 [exp] 106 / 1e-30 AT1G68585 84 / 9e-22 unknown protein Lus10021686 [exp] 104 / 1e-29 AT1G68585 92 / 5e-25 unknown protein Lus10000263 [exp] 44 / 5e-06 AT2G35730 54 / 1e-09 Heavy metal transport/detoxification superfamily protein (.1) Lus10032489 [exp] 41 / 3e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G126800.1 pacid=42798038 polypeptide=Potri.010G126800.1.p locus=Potri.010G126800 ID=Potri.010G126800.1.v4.1 annot-version=v4.1 ATGGCTCTTGCTTCACGGCCTAAAAAGGAGATACAAAGAATTGGAATCAAGAAGTCAAAGAACATGCTATATTCTGGAACTAGCCTGGCCTCTGCTGAAT CCTTAACCGTGCCTCTTGTTCAGGTAGTTGTTCTTTCAGCAGATATTCGATGTGCAGAATGTCAAAGGAGAGTAGCTGACATAATGTCAAGAATGAATGA GACAGAATCTGTATCGATCAATGTATTGGAAAAGAAGGTAACTCTCACTTGTAGGTATCCTGTTGTGAGAGTTTCTACAAGGCAAGTTGCTGCTGTATAC AGAAATCCTCTAGGCAAAATGGCAGTGATCAAGCGAATTTTTCGTTCTTACTGCCCTTGA
AA sequence Show only first row Show all	>Potri.010G126800.1 pacid=42798038 polypeptide=Potri.010G126800.1.p locus=Potri.010G126800 ID=Potri.010G126800.1.v4.1 annot-version=v4.1 MALASRPKKEIQRIGIKKSKNMLYSGTSLASAESLTVPLVQVVVLSADIRCAECQRRVADIMSRMNETESVSINVLEKKVTLTCRYPVVRVSTRQVAAVY RNPLGKMAVIKRIFRSYCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68585			unknown protein		Potri.010G126800 [exp]	0	1
AT5G62700		atgcp3, TUB3	tubulin beta chain 3 (.1)		Potri.001G272700 [exp]	3.00	0.9407
AT1G13635			DNA glycosylase superfamily pr...		Potri.008G112300 [exp]	4.89	0.9319
AT4G21160		ZAC, AGD12	ARF-GAP domain 12, Calcium-dep...		Potri.001G372000 [exp]	5.09	0.9356	Pt-ZAC.1
AT5G12250		TUB6	beta-6 tubulin (.1)		Potri.001G104600 [exp]	5.19	0.9254
AT5G46330		FLS2	FLAGELLIN-SENSITIVE 2, Leucine...		Potri.011G068500 [exp]	5.29	0.9198
AT1G68820			Transmembrane Fragile-X-F-asso...		Potri.008G116400 [exp]	7.48	0.9269
					Potri.003G074051 [exp]	7.93	0.9092
AT1G03900		ABCI18, ATNAP4	ATP-binding cassette I18, non-...		Potri.002G036400 [exp]	9.16	0.9322
AT4G17960			unknown protein		Potri.003G090600 [exp]	9.64	0.8985
AT5G54240			Protein of unknown function (D...		Potri.011G126300 [exp]	10.48	0.9287

Compare expression of checked genes

Potri.010G126800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.