Potri.010G127800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68630 151 / 1e-47 PLAC8 family protein (.1)
AT1G58320 143 / 2e-44 PLAC8 family protein (.1)
AT5G35525 128 / 2e-38 PLAC8 family protein (.1)
AT3G18450 127 / 1e-37 PLAC8 family protein (.1)
AT1G14870 125 / 3e-37 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1)
AT1G14880 114 / 8e-33 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1)
AT3G18460 112 / 6e-32 PLAC8 family protein (.1)
AT1G49030 112 / 3e-31 PLAC8 family protein (.1)
AT3G18470 105 / 1e-29 PLAC8 family protein (.1)
AT1G68610 97 / 4e-26 PCR11 PLANT CADMIUM RESISTANCE 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G092200 147 / 2e-45 AT1G14870 164 / 2e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.007G042800 130 / 3e-39 AT1G14870 152 / 7e-48 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G127700 131 / 6e-39 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1)
Potri.008G132775 129 / 2e-38 AT1G14870 185 / 2e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G108800 129 / 3e-38 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.008G132850 128 / 5e-38 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.008G132900 125 / 5e-37 AT1G14870 189 / 7e-62 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G109100 117 / 2e-33 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.012G060900 117 / 7e-32 AT1G49030 199 / 2e-62 PLAC8 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021696 134 / 2e-40 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10034298 123 / 4e-36 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10004063 119 / 4e-35 AT1G68630 132 / 2e-40 PLAC8 family protein (.1)
Lus10009036 114 / 4e-33 AT1G68630 122 / 2e-36 PLAC8 family protein (.1)
Lus10019478 114 / 2e-32 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10043325 112 / 1e-31 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10008890 106 / 7e-30 AT1G68630 119 / 6e-35 PLAC8 family protein (.1)
Lus10004064 94 / 5e-23 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1)
Lus10041474 79 / 7e-19 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10005257 67 / 2e-14 AT2G40935 228 / 6e-77 PLAC8 family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04749 PLAC8 PLAC8 family
Representative CDS sequence
>Potri.010G127800.2 pacid=42797029 polypeptide=Potri.010G127800.2.p locus=Potri.010G127800 ID=Potri.010G127800.2.v4.1 annot-version=v4.1
ATGGCTTCAAGGAGGGAAGGGACTGAATGCCCTGAAGCTGTTCCACCACCTTCACAATTTCCTGAAGGGCAATGGTCCACTGGGATATGCAATTGTTTTG
ATGACCCTTCTAACTGTTTGCTCACCTGTTTCTGTCCATGCATCACATTTGGACGGATAGCCGAGATCCTTGACAGGGGAAACACATCATGTCGACTTCA
AGGCCTCATCTACTGTGCCATGAGCCATATTGGCTGTGCGTGGCTATATGGTGGTATTTACCGATCTAAGCTGCGAGGTTTCCTTTCATTACCAGAAGCT
CCGTGCGCGGATTGGTTGGTCCATTGTTGCTGTTGTTTATGTTCTCTGTGTCAAGAGTATAGAGAGCTCAAAAATCATGGAGCTGATCCCTCTCTAGGTT
GGCAGGCTAATGTTGAGAAGTGGAACCGAGAGGGACTTAAACCCCCCTTTGTTGCGCCAGGCATGGATCGCTAA
AA sequence
>Potri.010G127800.2 pacid=42797029 polypeptide=Potri.010G127800.2.p locus=Potri.010G127800 ID=Potri.010G127800.2.v4.1 annot-version=v4.1
MASRREGTECPEAVPPPSQFPEGQWSTGICNCFDDPSNCLLTCFCPCITFGRIAEILDRGNTSCRLQGLIYCAMSHIGCAWLYGGIYRSKLRGFLSLPEA
PCADWLVHCCCCLCSLCQEYRELKNHGADPSLGWQANVEKWNREGLKPPFVAPGMDR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G68630 PLAC8 family protein (.1) Potri.010G127800 0 1
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.002G128000 1.41 0.9766
AT4G20820 FAD-binding Berberine family p... Potri.001G464800 4.89 0.9454
AT1G26560 BGLU40 beta glucosidase 40 (.1) Potri.010G159900 5.65 0.9508 HIUHASE.2
AT1G73165 CLE1 CLAVATA3/ESR-RELATED 1 (.1) Potri.011G096800 10.95 0.9222
AT2G17080 Arabidopsis protein of unknown... Potri.004G182550 12.56 0.8479
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Potri.016G101400 13.11 0.9344 RBE.1
AT1G27040 Major facilitator superfamily ... Potri.014G036200 14.07 0.9216
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.005G181500 14.83 0.8946
AT5G06800 GARP myb-like HTH transcriptional r... Potri.001G228500 18.73 0.9148
Potri.014G061500 19.94 0.7705

Potri.010G127800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.