Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13270 53 / 3e-09 MAP1B, MAP1C methionine aminopeptidase 1B (.1.2) AT3G25740 50 / 6e-08 MAP1C, MAP1B methionine aminopeptidase 1C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G117200 [exp] 80 / 8e-19 AT1G13270 531 / 0.0 methionine aminopeptidase 1B (.1.2) Potri.005G137400 [exp] 39 / 0.0004 AT4G37040 539 / 0.0 methionine aminopeptidase 1D (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021701 [exp] 65 / 3e-13 AT1G13270 518 / 0.0 methionine aminopeptidase 1B (.1.2) Lus10035045 [exp] 65 / 3e-13 AT1G13270 466 / 3e-165 methionine aminopeptidase 1B (.1.2) Lus10011514 [exp] 41 / 9e-05 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G129101.1 pacid=42798610 polypeptide=Potri.010G129101.1.p locus=Potri.010G129101 ID=Potri.010G129101.1.v4.1 annot-version=v4.1 ATGCCTGGTGATATTCCAAAGCCTCCATCAAATGAGTTGCCAGAGACTTCAAGTGAGCATCAGATTCATGACTCTGAATGGATTGTTAAAATGAGGGCTG CTTGCGAGCTTGCTGCTCACGTTTTGGAGAATGCTGGGTGTTTCAAGTTTTCATATGCTTGTCACGCTGGACGAATCATTTTCTGGAAAGCAAATTTCTA TCCATCAAATCATAATAACAAATTTCTTCAACTTTCATGGAACAGTCAAAGCGTTTGCTTGACTGGTGTGGCCAGTTGTCAATTGACTTGTTTTCTAGGT GTTATGAATGAGCATGCTTTGATGGGAATTTTCGCAAATGACTTTATGCTTGCTTAG
AA sequence Show only first row Show all	>Potri.010G129101.1 pacid=42798610 polypeptide=Potri.010G129101.1.p locus=Potri.010G129101 ID=Potri.010G129101.1.v4.1 annot-version=v4.1 MPGDIPKPPSNELPETSSEHQIHDSEWIVKMRAACELAAHVLENAGCFKFSYACHAGRIIFWKANFYPSNHNNKFLQLSWNSQSVCLTGVASCQLTCFLG VMNEHALMGIFANDFMLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13270		MAP1B, MAP1C	methionine aminopeptidase 1B (...		Potri.010G129101 [exp]	0	1
AT1G54870			NAD(P)-binding Rossmann-fold s...		Potri.010G092400 [exp]	15.03	0.9562
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G138201 [exp]	18.24	0.9546
AT1G78850			D-mannose binding lectin prote...		Potri.011G110000 [exp]	20.37	0.9533
AT1G32780			GroES-like zinc-binding dehydr...		Potri.011G152900 [exp]	23.06	0.9426
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Potri.016G056600 [exp]	23.32	0.9543
AT1G04590		EMB2748	unknown protein		Potri.006G091500 [exp]	24.57	0.9152
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.019G004500 [exp]	33.04	0.9521	QLEG.3
AT1G78940			Protein kinase protein with ad...		Potri.014G001700 [exp]	35.09	0.9447
AT3G54340	MADS	AP3, ATAP3	APETALA 3, K-box region and MA...		Potri.002G028400 [exp]	42.19	0.9456	Pt-APETALA3.1
AT3G50310		MKKK20, MAPKKK2...	MAPKK kinase 20, mitogen-activ...		Potri.009G131100 [exp]	42.19	0.9277

Compare expression of checked genes

Potri.010G129101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.