Potri.010G129532 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68830 296 / 1e-98 STN7 STT7 homolog STN7 (.1)
AT5G01920 131 / 5e-36 STN8 State transition 8, Protein kinase superfamily protein (.1)
AT1G13350 51 / 1e-07 Protein kinase superfamily protein (.1.2)
AT1G50240 49 / 1e-06 FU FUSED, Protein kinase family protein with ARM repeat domain (.2)
AT3G17750 48 / 2e-06 Protein kinase superfamily protein (.1)
AT3G53640 47 / 2e-06 Protein kinase superfamily protein (.1)
AT2G23080 47 / 4e-06 CKA3 casein kinase II, alpha chain 3, Protein kinase superfamily protein (.1.2)
AT2G23070 46 / 5e-06 Protein kinase superfamily protein (.1)
AT1G73460 46 / 6e-06 Protein kinase superfamily protein (.1)
AT5G67380 46 / 6e-06 ATCKA1, CKA1 casein kinase alpha 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G116800 300 / 3e-100 AT1G68830 883 / 0.0 STT7 homolog STN7 (.1)
Potri.016G138500 129 / 3e-35 AT5G01920 596 / 0.0 State transition 8, Protein kinase superfamily protein (.1)
Potri.006G109700 127 / 2e-34 AT5G01920 597 / 0.0 State transition 8, Protein kinase superfamily protein (.1)
Potri.008G166500 53 / 2e-08 AT1G08650 287 / 2e-97 phosphoenolpyruvate carboxylase kinase 1 (.1.2)
Potri.012G039700 49 / 5e-07 AT1G73460 1343 / 0.0 Protein kinase superfamily protein (.1)
Potri.001G278600 49 / 6e-07 AT1G07150 353 / 2e-117 mitogen-activated protein kinase kinase kinase 13 (.1.2)
Potri.010G071400 49 / 6e-07 AT1G08650 298 / 1e-101 phosphoenolpyruvate carboxylase kinase 1 (.1.2)
Potri.015G033400 49 / 6e-07 AT1G73460 1356 / 0.0 Protein kinase superfamily protein (.1)
Potri.013G046100 47 / 2e-06 AT3G04530 366 / 1e-128 phosphoenolpyruvate carboxylase kinase 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034273 285 / 2e-94 AT1G68830 832 / 0.0 STT7 homolog STN7 (.1)
Lus10041490 172 / 4e-51 AT1G68830 754 / 0.0 STT7 homolog STN7 (.1)
Lus10014183 127 / 1e-34 AT5G01920 651 / 0.0 State transition 8, Protein kinase superfamily protein (.1)
Lus10022730 103 / 8e-26 AT5G01920 530 / 0.0 State transition 8, Protein kinase superfamily protein (.1)
Lus10034288 50 / 2e-07 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10019296 48 / 1e-06 AT2G23070 631 / 0.0 Protein kinase superfamily protein (.1)
Lus10011526 48 / 2e-06 AT2G23070 632 / 0.0 Protein kinase superfamily protein (.1)
Lus10031328 47 / 2e-06 AT1G73450 405 / 6e-135 Protein kinase superfamily protein (.1)
Lus10032849 47 / 3e-06 AT5G67380 563 / 0.0 casein kinase alpha 1 (.1.2)
Lus10030868 47 / 3e-06 AT3G01490 253 / 3e-81 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.010G129532.1 pacid=42796903 polypeptide=Potri.010G129532.1.p locus=Potri.010G129532 ID=Potri.010G129532.1.v4.1 annot-version=v4.1
ATGCAGAGTAAAGAGTTCCCCTATAATGTAGAAACAATGATACTAGGAGAGGCTCAGGACTTGCCTAAGGGGCTGGAGAGGGATAACAGAATCATTCAAA
CTATCATGACACAACTTTTATTTGCGTTGGATGGTCTTCACTCAACAGGAATTGTGCATGGGGATATTAAACCGCAGAACATTATTTTTTCTGAAGGGTC
TCGTACATTTAAGATCATTGATCTTGGAGCTGCAGCGGATTTGCGAGCGGGAATCAATTATATTCCAAAAGAATTTCTTTTGGACCCGAGATACGCTGTA
CCAGAGCAATACATCATGAGCACACAAACTCCATCCGCACCCTCAGCTCCAGTGGCAACTGCACTTTCCCCAGTTCTTTGGCAGGCTTTTCCTGGACTAC
GTTCTGATAGTGGGCTCATACAGTTCAACCGTCATTTAAAACGATGTGATTATGACCTAATTGCATGGAGGAAAAGCGTAGAGACACGTGCCAGCTCTGA
TCTTCGAAGGGGTTTTGAGTTATTGGATTTAGATGGTGGGATAGGATGGGAACTTCTTAACTTTGATGGTCCGATATAA
AA sequence
>Potri.010G129532.1 pacid=42796903 polypeptide=Potri.010G129532.1.p locus=Potri.010G129532 ID=Potri.010G129532.1.v4.1 annot-version=v4.1
MQSKEFPYNVETMILGEAQDLPKGLERDNRIIQTIMTQLLFALDGLHSTGIVHGDIKPQNIIFSEGSRTFKIIDLGAAADLRAGINYIPKEFLLDPRYAV
PEQYIMSTQTPSAPSAPVATALSPVLWQAFPGLRSDSGLIQFNRHLKRCDYDLIAWRKSVETRASSDLRRGFELLDLDGGIGWELLNFDGPI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G68830 STN7 STT7 homolog STN7 (.1) Potri.010G129532 0 1
AT3G62910 APG3 ALBINO AND PALE GREEN, Peptide... Potri.014G133400 5.47 0.8726 APG3.1
AT1G03160 FZL FZO-like (.1.2) Potri.005G209200 6.16 0.9108
AT1G07540 MYB TRFL2 TRF-like 2 (.1) Potri.009G032000 11.18 0.8526
Potri.018G145600 14.96 0.8795
AT4G02260 AT-RSH1, RSH1, ... RELA-SPOT HOMOLOG 1, RELA/SPOT... Potri.014G126700 15.03 0.9059 RSH1.2
AT1G64430 Pentatricopeptide repeat (PPR)... Potri.001G090800 16.49 0.8786
AT2G04270 RNEE/G RNAse E/G-like (.1.2.3.4.5) Potri.014G170300 24.81 0.8687
AT5G51690 ACS12 1-amino-cyclopropane-1-carboxy... Potri.015G132100 25.09 0.8854
AT5G62620 Galactosyltransferase family p... Potri.012G072400 25.92 0.8675
AT4G18240 ATSS4, SSIV ARABIDOPSIS THALIANA STARCH SY... Potri.001G351800 26.87 0.8634

Potri.010G129532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.