Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	CLE12.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68795 65 / 1e-14 CLE12 CLAVATA3/ESR-RELATED 12 (.1) AT1G73965 64 / 1e-14 CLE13 CLAVATA3/ESR-RELATED 13 (.1) AT1G26600 47 / 8e-08 CLE9 CLAVATA3/ESR-RELATED 9 (.1) AT1G69320 47 / 1e-07 CLE10 CLAVATA3/ESR-RELATED 10 (.1) AT1G49005 44 / 1e-06 CLE11 CLAVATA3/ESR-RELATED 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G115600 [exp] 113 / 1e-33 AT1G73965 67 / 1e-15 CLAVATA3/ESR-RELATED 13 (.1) Potri.012G059600 [exp] 66 / 5e-15 AT1G68795 59 / 3e-12 CLAVATA3/ESR-RELATED 12 (.1) Potri.008G093500 [exp] 50 / 8e-09 AT1G69320 62 / 1e-13 CLAVATA3/ESR-RELATED 10 (.1) Potri.010G160600 [exp] 48 / 9e-08 AT1G69320 48 / 1e-07 CLAVATA3/ESR-RELATED 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041496 [exp] 58 / 9e-12 AT1G68795 61 / 7e-13 CLAVATA3/ESR-RELATED 12 (.1) Lus10034267 [exp] 56 / 5e-11 AT1G68795 59 / 7e-12 CLAVATA3/ESR-RELATED 12 (.1) Lus10036960 [exp] 47 / 1e-07 AT1G69320 52 / 1e-09 CLAVATA3/ESR-RELATED 10 (.1) Lus10037107 [exp] 47 / 1e-07 AT1G73965 51 / 3e-09 CLAVATA3/ESR-RELATED 13 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G130400.1 pacid=42799758 polypeptide=Potri.010G130400.1.p locus=Potri.010G130400 ID=Potri.010G130400.1.v4.1 annot-version=v4.1 ATGGCCTTGAGAATTTTTCACACTCTATGCGTCGTTTTTTGGCTCTCCCTTCTCTTGTTAGTGTTTCATGAATTGTGTAATTTCAAGTCCAAGATCAACA GCACCAAAGACCAAATCAACAACATAAGCAAATCATCAACATTCTCTTATCGCCCTTTCCTCACCAGAAAAGTTGTTGCTAGGAAATTCGACTTCACCCC ATTTCAAAAACATCACCAACAACCTATGCCTGAGGAAGAGGGGCACAAGAAACGAGCTCGAAGTGAGATTGATCCACGTTATGGTGTCGAAAAGCGCCTC GTCCCCACCGGTCCTAACCCTTTGCACCATTGA
AA sequence Show only first row Show all	>Potri.010G130400.1 pacid=42799758 polypeptide=Potri.010G130400.1.p locus=Potri.010G130400 ID=Potri.010G130400.1.v4.1 annot-version=v4.1 MALRIFHTLCVVFWLSLLLLVFHELCNFKSKINSTKDQINNISKSSTFSYRPFLTRKVVARKFDFTPFQKHHQQPMPEEEGHKKRARSEIDPRYGVEKRL VPTGPNPLHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68795		CLE12	CLAVATA3/ESR-RELATED 12 (.1)		Potri.010G130400 [exp]	0	1	CLE12.1
AT4G10550			Subtilase family protein (.1.2...		Potri.011G146300 [exp]	4.24	0.8198
AT1G79620			Leucine-rich repeat protein ki...		Potri.016G144100 [exp]	5.38	0.8332
AT5G25830	GATA	GATA12	GATA transcription factor 12 (...		Potri.006G237700 [exp]	6.24	0.7938
AT2G04780		FLA7	FASCICLIN-like arabinoogalacta...		Potri.014G162900 [exp]	7.21	0.7616
AT1G69420			DHHC-type zinc finger family p...		Potri.010G163200 [exp]	8.24	0.7834
AT1G76620			Protein of unknown function, D...		Potri.002G001900 [exp]	8.36	0.8006
AT1G09610			Protein of unknown function (D...		Potri.019G076300 [exp]	8.77	0.8025
AT3G55420			unknown protein		Potri.008G055800 [exp]	9.59	0.8238
AT4G24015			RING/U-box superfamily protein...		Potri.003G142600 [exp]	10.00	0.7800
AT2G20650			RING/U-box superfamily protein...		Potri.007G139300 [exp]	10.77	0.8127

Compare expression of checked genes

Potri.010G130400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.