Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25600 228 / 6e-78 Calcium-binding EF-hand family protein (.1) AT1G18530 224 / 3e-76 EF hand calcium-binding protein family (.1) AT3G03000 126 / 2e-37 EF hand calcium-binding protein family (.1) AT1G32250 123 / 3e-36 Calcium-binding EF-hand family protein (.1) AT3G43810 97 / 2e-26 CAM7 calmodulin 7 (.1) AT5G37780 96 / 7e-26 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT1G66410 96 / 7e-26 ACAM-4, CAM4 calmodulin 4 (.1.2) AT2G41110 96 / 8e-26 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT2G27030 96 / 8e-26 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT3G56800 96 / 8e-26 ACAM-3, CAM3 calmodulin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G052600 [exp] 217 / 2e-73 AT1G18530 213 / 8e-72 EF hand calcium-binding protein family (.1) Potri.003G095700 [exp] 132 / 9e-40 AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) Potri.001G138000 [exp] 130 / 3e-39 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.006G026700 [exp] 97 / 2e-26 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 97 / 2e-26 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.016G024700 [exp] 97 / 2e-26 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.001G222200 [exp] 98 / 5e-26 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.010G080900 [exp] 94 / 8e-25 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1) Potri.012G041000 [exp] 92 / 4e-24 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017900 [exp] 244 / 8e-84 AT3G25600 252 / 4e-87 Calcium-binding EF-hand family protein (.1) Lus10027243 [exp] 182 / 1e-59 AT1G18530 208 / 5e-70 EF hand calcium-binding protein family (.1) Lus10004610 [exp] 127 / 1e-37 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10030986 [exp] 121 / 2e-35 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1) Lus10004539 [exp] 100 / 4e-28 AT3G03000 164 / 2e-53 EF hand calcium-binding protein family (.1) Lus10027283 [exp] 97 / 3e-26 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 97 / 3e-26 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 97 / 3e-26 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10041288 [exp] 97 / 3e-26 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10039391 [exp] 97 / 4e-26 AT4G14640 268 / 1e-93 calmodulin-like 8, calmodulin 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.010G132800.1 pacid=42799082 polypeptide=Potri.010G132800.1.p locus=Potri.010G132800 ID=Potri.010G132800.1.v4.1 annot-version=v4.1 ATGATGGCAACCCTTCAGACCGATCAGCTCAAGCAGCTCAAGGACATCTTCATTCGCTTCGACATGGATTCCGATGGCAGCCTCACGCAGCTGGAGCTCG CTGCGCTTCTACGTTCTCTTGGCCTCAAACCTACAGGTGATCAACTTCATGTTCTGTTATCAAACATGGATGCTAATGGAAATGGTTATGTTGAGTTTGA TGAGCTGGTCAGTGCTATATTGCCTGATATGAATGAAGAAGTATTGATCAACCAGGAGCAGTTGTTGGAGGTTTTTCGATCATTTGACAGGGATGGCAAT GGATTCATTACTGCTGCTGAGCTTGCAGGATCAATGGCTAAAATGGGACACCCTTTGACGTATCGTGAGCTATCAGATATGATGAGAGAGGCTGACACCA ATGGAGATGGTGTTTTGAGTTTTAATGAGTTTGCAAACGTCATGGCAAAATCTGCTGCTGATTTTCTTGGCATCAAAGTTCCATAG
AA sequence Show only first row Show all	>Potri.010G132800.1 pacid=42799082 polypeptide=Potri.010G132800.1.p locus=Potri.010G132800 ID=Potri.010G132800.1.v4.1 annot-version=v4.1 MMATLQTDQLKQLKDIFIRFDMDSDGSLTQLELAALLRSLGLKPTGDQLHVLLSNMDANGNGYVEFDELVSAILPDMNEEVLINQEQLLEVFRSFDRDGN GFITAAELAGSMAKMGHPLTYRELSDMMREADTNGDGVLSFNEFANVMAKSAADFLGIKVP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25600			Calcium-binding EF-hand family...		Potri.010G132800 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Potri.009G056200 [exp]	8.12	0.8329
AT5G46290		KAS1, KAS I, KA...	KETOACYL-ACP SYNTHASE 1, 3-ket...		Potri.001G088700 [exp]	10.77	0.8539
AT2G14960		GH3.1	Auxin-responsive GH3 family pr...		Potri.009G092900 [exp]	16.06	0.8432
AT1G66400		CML23	calmodulin like 23 (.1)		Potri.017G126200 [exp]	17.49	0.7932	Pt-TCH2.1
AT2G16900			Arabidopsis phospholipase-like...		Potri.004G176100 [exp]	23.66	0.8153
AT5G51460		ATTPPA	Haloacid dehalogenase-like hyd...		Potri.012G126100 [exp]	41.27	0.8155	Pt-ATTPPA.3
AT3G02430			Protein of unknown function (D...		Potri.004G223500 [exp]	41.89	0.8130
AT5G41810			unknown protein		Potri.001G093500 [exp]	53.21	0.7878
AT1G45688			unknown protein		Potri.014G026800 [exp]	56.23	0.7647
AT4G36950		MAPKKK21	mitogen-activated protein kina...		Potri.003G184200 [exp]	59.39	0.7891

Compare expression of checked genes

Potri.010G132800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.