Potri.010G133001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26160 84 / 3e-21 Metal-dependent phosphohydrolase (.1)
AT2G23820 70 / 6e-16 Metal-dependent phosphohydrolase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G111700 90 / 1e-23 AT1G26160 352 / 9e-124 Metal-dependent phosphohydrolase (.1)
Potri.006G178600 71 / 2e-16 AT2G23820 305 / 2e-105 Metal-dependent phosphohydrolase (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017897 81 / 5e-20 AT1G26160 329 / 2e-114 Metal-dependent phosphohydrolase (.1)
Lus10015497 71 / 2e-16 AT2G23820 331 / 2e-115 Metal-dependent phosphohydrolase (.1.2)
Lus10019968 71 / 4e-16 AT2G23820 332 / 1e-115 Metal-dependent phosphohydrolase (.1.2)
Lus10035072 64 / 2e-13 AT1G26160 319 / 5e-110 Metal-dependent phosphohydrolase (.1)
PFAM info
Representative CDS sequence
>Potri.010G133001.1 pacid=42796883 polypeptide=Potri.010G133001.1.p locus=Potri.010G133001 ID=Potri.010G133001.1.v4.1 annot-version=v4.1
ATGCTTCTTCAATTGATTTTCTTGCTATTGCAATGTGCGGTGAAAGTCATTGAAACACAGGACAGTATTCAAATCAATTGTGTTTGCCAGGTTGAGATGA
TTTTGCGAGCACTGGAATATGAAATGGAACAAGGGAAGGTGTTGGATGAGTTTTTCTTTTCAGCAGCAGGAAAATTTCGAACTGCGATAGGAAAGAGCTG
GGCAGCTGAGATTTCTTCAAGAAGAAACTCTATTCTGGCCAGGAAGCAAAACTGA
AA sequence
>Potri.010G133001.1 pacid=42796883 polypeptide=Potri.010G133001.1.p locus=Potri.010G133001 ID=Potri.010G133001.1.v4.1 annot-version=v4.1
MLLQLIFLLLQCAVKVIETQDSIQINCVCQVEMILRALEYEMEQGKVLDEFFFSAAGKFRTAIGKSWAAEISSRRNSILARKQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G26160 Metal-dependent phosphohydrola... Potri.010G133001 0 1
AT2G38720 MAP65-5 microtubule-associated protein... Potri.001G032566 7.93 0.7057
AT1G75010 ARC3 ACCUMULATION AND REPLICATION O... Potri.008G142301 12.96 0.7038
AT2G45530 RING/U-box superfamily protein... Potri.001G452800 13.03 0.7020
AT5G01075 Glycosyl hydrolase family 35 p... Potri.014G017600 16.61 0.7075
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Potri.010G211000 18.43 0.7248
AT2G32645 Domain of unknown function (DU... Potri.011G139000 19.74 0.6613
AT2G23093 Major facilitator superfamily ... Potri.007G052700 21.84 0.7030
AT2G14170 ALDH6B2 aldehyde dehydrogenase 6B2 (.... Potri.009G078700 27.27 0.6952
AT1G70140 ATFH8 formin 8 (.1) Potri.015G069800 34.64 0.6442
AT4G16460 unknown protein Potri.006G016100 35.07 0.6548

Potri.010G133001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.