Potri.010G133200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61460 68 / 5e-15 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT2G04240 66 / 3e-14 XERICO RING/U-box superfamily protein (.1.2)
AT2G01150 64 / 1e-13 RHA2B RING-H2 finger protein 2B (.1)
AT1G15100 63 / 2e-13 RHA2A RING-H2 finger A2A (.1)
AT3G43430 63 / 3e-13 RING/U-box superfamily protein (.1)
AT4G10150 62 / 2e-12 RING/U-box superfamily protein (.1)
AT1G63840 60 / 4e-12 RING/U-box superfamily protein (.1)
AT5G20885 60 / 6e-12 RING/U-box superfamily protein (.1)
AT4G11370 59 / 1e-11 RHA1A RING-H2 finger A1A (.1)
AT2G17450 57 / 5e-11 RHA3A RING-H2 finger A3A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G133300 275 / 4e-97 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133700 263 / 3e-92 AT3G61460 66 / 4e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.005G081300 67 / 7e-15 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.007G086300 67 / 1e-14 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.005G081200 66 / 3e-14 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.007G086200 65 / 7e-14 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.007G086100 65 / 8e-14 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.014G087700 64 / 9e-14 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.014G170400 63 / 3e-13 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019150 83 / 4e-21 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2)
Lus10034407 80 / 7e-20 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2)
Lus10036378 67 / 2e-14 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 66 / 3e-14 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 66 / 5e-14 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 65 / 1e-13 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10007937 61 / 2e-12 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1)
Lus10028773 60 / 6e-12 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10020258 60 / 3e-11 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10003617 58 / 3e-11 AT2G01150 63 / 6e-13 RING-H2 finger protein 2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.010G133200.1 pacid=42796846 polypeptide=Potri.010G133200.1.p locus=Potri.010G133200 ID=Potri.010G133200.1.v4.1 annot-version=v4.1
ATGTTCATCAAATACTTAAATCTTATTAGTGCCCATCTCAGATGGGCATTTAATTTCTTGTGTTACTATCCGTTCAGCTTCCAAGAACATGAATTGTTTG
CTGTGACTGCAATTGGTGAAGAACTAAACACGGTGATCAATGAAGCTCCTGCGGAATGTGCTGTGTGTCTAAGTGACGTTCAAGAAGGCGAAGAAATCAG
AGAGCTGAGATGTGGGCATATCTTTCATAGAGCATGCTTATACAGATGGCTTGACTTCCGGCAATCGACTTGCCCACTTTGCCGAGGAAGTCTTACTCCC
CGGAGAACATTGATCCTTGATCAGCACCGAACAGAAGTATTGACGTTCAAGTTCTGTTCTTTCACATCCACCGATGAACGTGATACATGGTGGCTACGAT
GA
AA sequence
>Potri.010G133200.1 pacid=42796846 polypeptide=Potri.010G133200.1.p locus=Potri.010G133200 ID=Potri.010G133200.1.v4.1 annot-version=v4.1
MFIKYLNLISAHLRWAFNFLCYYPFSFQEHELFAVTAIGEELNTVINEAPAECAVCLSDVQEGEEIRELRCGHIFHRACLYRWLDFRQSTCPLCRGSLTP
RRTLILDQHRTEVLTFKFCSFTSTDERDTWWLR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133200 0 1
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133300 1.00 0.9968
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Potri.007G021300 2.82 0.8597
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.002G104450 3.00 0.8970
AT4G20970 bHLH bHLH162 basic helix-loop-helix (bHLH) ... Potri.012G079100 3.46 0.9347
AT2G32990 ATGH9B8 glycosyl hydrolase 9B8 (.1) Potri.014G157600 5.19 0.8568
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Potri.002G150500 5.91 0.8650 CYP76.3
Potri.010G133401 8.94 0.8833
AT5G57520 C2H2ZnF ATZFP2, ZFP2 zinc finger protein 2 (.1) Potri.006G169800 9.94 0.8404
AT4G27290 S-locus lectin protein kinase ... Potri.001G413300 12.04 0.7851
AT1G10740 alpha/beta-Hydrolases superfam... Potri.008G187900 24.26 0.7737

Potri.010G133200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.