Potri.010G133401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G133401.1 pacid=42800250 polypeptide=Potri.010G133401.1.p locus=Potri.010G133401 ID=Potri.010G133401.1.v4.1 annot-version=v4.1
ATGAAACAAAAATCTCAACATCGTCTTTCCATTCAACTCTCTCCTGTATTATTCTTGGATCTTAGCGAGATTTTGAAAGATTCACCAAAATTAACTAAAA
AACACTTACCAAACATCAAGTTTATTACAAGCATGGCTAAGAGACAACATGCATGGCATTGCAGGACTGTTATTAGAGATTCCGAGAGGGAGATGGCTTC
ACCCTTTCAGGAATTAACGATCACTTCATGCTTGAGAAGTTTGCATCAATAG
AA sequence
>Potri.010G133401.1 pacid=42800250 polypeptide=Potri.010G133401.1.p locus=Potri.010G133401 ID=Potri.010G133401.1.v4.1 annot-version=v4.1
MKQKSQHRLSIQLSPVLFLDLSEILKDSPKLTKKHLPNIKFITSMAKRQHAWHCRTVIRDSEREMASPFQELTITSCLRSLHQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G133401 0 1
AT4G20970 bHLH bHLH162 basic helix-loop-helix (bHLH) ... Potri.012G079100 2.44 0.9388
AT4G27290 S-locus lectin protein kinase ... Potri.011G125801 2.64 0.9416
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.002G104450 6.00 0.8962
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133200 8.94 0.8833
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Potri.008G183100 17.02 0.7339
AT4G27290 S-locus lectin protein kinase ... Potri.001G413300 18.43 0.8247
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.015G032100 19.36 0.9386 TPS1.4
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133300 22.02 0.8673
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Potri.013G157400 24.49 0.9360
AT3G25180 CYP82G1 cytochrome P450, family 82, su... Potri.013G125300 27.92 0.9320 Pt-CYP82.15

Potri.010G133401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.