Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61460 65 / 9e-14 BRH1 brassinosteroid-responsive RING-H2 (.1) AT2G04240 60 / 3e-12 XERICO RING/U-box superfamily protein (.1.2) AT3G43430 59 / 1e-11 RING/U-box superfamily protein (.1) AT2G01150 58 / 2e-11 RHA2B RING-H2 finger protein 2B (.1) AT1G15100 57 / 4e-11 RHA2A RING-H2 finger A2A (.1) AT1G63840 57 / 6e-11 RING/U-box superfamily protein (.1) AT4G11370 56 / 1e-10 RHA1A RING-H2 finger A1A (.1) AT5G20885 56 / 1e-10 RING/U-box superfamily protein (.1) AT4G10150 55 / 7e-10 RING/U-box superfamily protein (.1) AT3G20395 55 / 8e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G133200 [exp] 263 / 3e-92 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1) Potri.010G133300 [exp] 261 / 1e-91 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1) Potri.005G081300 [exp] 63 / 3e-13 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1) Potri.005G081200 [exp] 63 / 3e-13 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1) Potri.014G170400 [exp] 62 / 6e-13 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2) Potri.007G086300 [exp] 62 / 6e-13 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1) Potri.014G087700 [exp] 61 / 2e-12 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1) Potri.007G086200 [exp] 61 / 3e-12 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1) Potri.002G161900 [exp] 59 / 8e-12 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019150 [exp] 76 / 2e-18 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2) Lus10034407 [exp] 74 / 9e-18 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2) Lus10036378 [exp] 64 / 3e-13 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1) Lus10032290 [exp] 62 / 1e-12 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10024657 [exp] 61 / 2e-12 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10017510 [exp] 61 / 4e-12 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10007937 [exp] 56 / 1e-10 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1) Lus10028773 [exp] 56 / 3e-10 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10008283 [exp] 55 / 5e-10 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1) Lus10020258 [exp] 56 / 7e-10 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.010G133700.1 pacid=42797669 polypeptide=Potri.010G133700.1.p locus=Potri.010G133700 ID=Potri.010G133700.1.v4.1 annot-version=v4.1 ATGTTCATCAAGTACCTAAATATCATTAGTGTCCATCTCAGATGGACATTTAATTTCTTGTGTTACTATCCGTTCAACTTCCAAGAACACGAATTGTTTG CTGTGCCTGCAATTGGTGAAGAACTAAACACGGTGATCAATGAAGCTCCTGCGGAATGTGCTGTGTGTCTAAGTGATGTTGAAGAAGGCGAAGAAATCAG AGAGCTGAGATGTGGGCATATCTTTCATAGAGCATGCTTATACAGATTGCTTGACTTCCGGCAATCGACTTGCCCACTTTGCCGAGGAAGTCTTACTCCC CGGAGAACATTGATCCTTGATCAGCACCAAACAGAAGTATTGACGTTCAAGTTCTGTTCTTTCACATCCACCGATGAACGTGATACATGGTGGCTACGAT GA
AA sequence Show only first row Show all	>Potri.010G133700.1 pacid=42797669 polypeptide=Potri.010G133700.1.p locus=Potri.010G133700 ID=Potri.010G133700.1.v4.1 annot-version=v4.1 MFIKYLNIISVHLRWTFNFLCYYPFNFQEHELFAVPAIGEELNTVINEAPAECAVCLSDVEEGEEIRELRCGHIFHRACLYRLLDFRQSTCPLCRGSLTP RRTLILDQHQTEVLTFKFCSFTSTDERDTWWLR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61460		BRH1	brassinosteroid-responsive RIN...		Potri.010G133700 [exp]	0	1
AT5G65940		CHY1	beta-hydroxyisobutyryl-CoA hyd...		Potri.006G277300 [exp]	8.00	0.9957
AT3G25180		CYP82G1	cytochrome P450, family 82, su...		Potri.013G125300 [exp]	8.36	0.9933	Pt-CYP82.15
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Potri.013G157400 [exp]	11.04	0.9916
AT5G50700		HSD1	hydroxysteroid dehydrogenase 1...		Potri.012G102000 [exp]	11.91	0.9945
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008906 [exp]	14.49	0.9944
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Potri.019G014454 [exp]	16.73	0.9943
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008902 [exp]	18.70	0.9943
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.015G032100 [exp]	20.29	0.9774	TPS1.4
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.005G106100 [exp]	20.59	0.9743	Pt-CTS2.5
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G212300 [exp]	20.63	0.9943

Compare expression of checked genes

Potri.010G133700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.