Potri.010G134500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68850 460 / 1e-163 Peroxidase superfamily protein (.1)
AT1G44970 284 / 2e-94 Peroxidase superfamily protein (.1)
AT4G36430 279 / 1e-92 Peroxidase superfamily protein (.1)
AT2G18150 273 / 3e-90 Peroxidase superfamily protein (.1)
AT5G58390 268 / 2e-88 Peroxidase superfamily protein (.1)
AT3G50990 267 / 1e-87 Peroxidase superfamily protein (.1)
AT5G58400 266 / 1e-87 Peroxidase superfamily protein (.1)
AT2G18140 265 / 4e-87 Peroxidase superfamily protein (.1)
AT5G05340 264 / 1e-86 Peroxidase superfamily protein (.1)
AT5G06730 263 / 9e-86 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G110600 597 / 0 AT1G68850 488 / 9e-175 Peroxidase superfamily protein (.1)
Potri.013G083600 281 / 1e-93 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.002G031200 281 / 4e-93 AT1G44970 492 / 6e-176 Peroxidase superfamily protein (.1)
Potri.014G143200 272 / 6e-90 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.001G458900 270 / 3e-89 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.007G019300 269 / 1e-88 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1)
Potri.003G214700 269 / 3e-88 AT5G06720 459 / 5e-163 peroxidase 2 (.1)
Potri.001G458700 266 / 1e-87 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.001G145800 266 / 1e-87 AT2G35380 458 / 6e-163 Peroxidase superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029094 444 / 2e-157 AT1G68850 439 / 1e-155 Peroxidase superfamily protein (.1)
Lus10013065 436 / 3e-154 AT1G68850 431 / 2e-152 Peroxidase superfamily protein (.1)
Lus10010634 276 / 2e-91 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Lus10041784 273 / 5e-90 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1)
Lus10006534 272 / 9e-90 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10034207 263 / 2e-86 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10032786 262 / 4e-86 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10027989 263 / 1e-85 AT5G06720 400 / 1e-139 peroxidase 2 (.1)
Lus10024209 262 / 1e-85 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10008173 261 / 7e-85 AT5G06730 407 / 3e-142 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.010G134500.1 pacid=42798527 polypeptide=Potri.010G134500.1.p locus=Potri.010G134500 ID=Potri.010G134500.1.v4.1 annot-version=v4.1
ATGGCGTTTCCCCTTCATGAATCAAAGCTTCCCGTATTACCACTTGCTATGCTGGTTTTTATCTCCATCCTCAGCGGAAGCTTGCATGCAAGTGACCCTC
CTTTAACTTTGGACCACTATGCTTCGACATGCCCCGATGTGTTTGAGATTGTCAAGAAAGAAATGGAATGTGAAGTTCTTTCTGATCCACGTAATGCAGC
TTTGATATTGAGATTACATTTCCATGACTGCTTCGTTCAGGGGTGTGATGGTTCAGTATTGCTAGACGACACAATCACCTTGCAAGGGGAAAAGGAAGCT
TTAACAAACACAAACTCTCTGAAAGGATTTAAAATCATTGATAGAATTAAGAACAAGATCGAGTCCGAGTGCCCTGGAATAGTCTCTTGTGCAGATATCC
TCACCATCGCCGCAAGAGATGCAGTCATTCTGGTTGGTGGACCATACTGGGATGTTCCTGTGGGAAGGAAAGATTCTAAAACTGCAAGTTTCGAGCTCGC
AGCATCAAATCTTCCAACAGCAGATGAGGGTCTGCTATCTATCATGACCAAGTTCCTTTACCAGGGCCTTTCAGCTACTGATTTGGTAGCTCTTTCAGGG
GCGCACACTATTGGCATGGCACGTTGTGCGAATTTTCGATCAAGGATTTACGGGGACTTTGAAACAACTTCGGATGCAAGTCCAATGTCTGAGACCTATC
TCAACAGCTTGAAATCGACGTGCCCAGCTGCTGGAGGATCTGGGGACAATAACATATCAGCGATGGACTATGCCACGCCTAATCTTTTTGACAACTCTTT
CTATCAATTACTATTGAAAGGAGATGGACTGCTAAGCTCAGACCAGGAACTGTACTCAAGCATGCTTGGGATCGAAACAAAGAATCTTGTGATAAAGTAT
GCTCATGACTCCCTTGCTTTCTTTCAGCAATTCGCAGATTCTATGGTGAAAATGGGAAATATTACAAATCCTGATAGCTTCGTCAACGGGGAAGTTAGGA
CAAACTGCAGATTTGTGAACACATGA
AA sequence
>Potri.010G134500.1 pacid=42798527 polypeptide=Potri.010G134500.1.p locus=Potri.010G134500 ID=Potri.010G134500.1.v4.1 annot-version=v4.1
MAFPLHESKLPVLPLAMLVFISILSGSLHASDPPLTLDHYASTCPDVFEIVKKEMECEVLSDPRNAALILRLHFHDCFVQGCDGSVLLDDTITLQGEKEA
LTNTNSLKGFKIIDRIKNKIESECPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSKTASFELAASNLPTADEGLLSIMTKFLYQGLSATDLVALSG
AHTIGMARCANFRSRIYGDFETTSDASPMSETYLNSLKSTCPAAGGSGDNNISAMDYATPNLFDNSFYQLLLKGDGLLSSDQELYSSMLGIETKNLVIKY
AHDSLAFFQQFADSMVKMGNITNPDSFVNGEVRTNCRFVNT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G68850 Peroxidase superfamily protein... Potri.010G134500 0 1
AT5G58860 CYP86A1 "cytochrome P450, family 86, s... Potri.009G043700 1.41 0.9886 CYP86A19,Pt-CYP86.4
AT4G20390 Uncharacterised protein family... Potri.011G154900 2.00 0.9882
AT5G41040 HXXXD-type acyl-transferase fa... Potri.001G326300 2.82 0.9788
AT1G29000 Heavy metal transport/detoxifi... Potri.014G178800 3.46 0.9722
AT1G53270 ABCG10 ATP-binding cassette G10, ABC-... Potri.001G393300 3.46 0.9797 3
AT5G58860 CYP86A1 "cytochrome P450, family 86, s... Potri.001G249700 4.00 0.9671 CYP86.5
AT2G23540 GDSL-like Lipase/Acylhydrolase... Potri.007G036300 5.91 0.9707
Potri.017G046750 6.70 0.9517
AT3G18400 NAC ANAC058 NAC domain containing protein ... Potri.012G056300 7.41 0.9760
AT3G07990 SCPL27 serine carboxypeptidase-like 2... Potri.010G220200 7.41 0.9563

Potri.010G134500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.