Plant FIBer expression Database

Potri.010G135150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06404 PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence
>Potri.010G135150.1 pacid=42799710 polypeptide=Potri.010G135150.1.p locus=Potri.010G135150 ID=Potri.010G135150.1.v4.1 annot-version=v4.1
ATGTTTGACTTTTGGTGGCATGATTTCAATGCTCATTTATGGAGGAGCCTTCCCCTTACTCTCCATCCCAAGTCGGTCTCACTTCTCGATACACCGCCTC
AATTATATAAGGTAGCAAACCTTTTCATCACCTTCCATTTATCTCCACAAGCTCTTCCTGTCTTAATCACAAAAATGCCAAGGAAGCTCACTTTCTTAAT
GATGGTACTGTTTCTTTTATCCTCAGGTGCAAAATCCAGGTCTATTTCAGCCTCCACCAGGGCAGAATCCACACCGCCGGAAACATCCTCACACATTCCT
GCGGGATCATCGCCTGGGGAGTCAAGCATCAATGATGAAGGGTACTCATGCTCTGGGTCAGAAAGTGAAGAAGAGTGTTTGATTAGACGGTCCATGGCTG
ATCATACAGACTATATCTACACACAAGATATAAGTGGACCATGA
AA sequence
>Potri.010G135150.1 pacid=42799710 polypeptide=Potri.010G135150.1.p locus=Potri.010G135150 ID=Potri.010G135150.1.v4.1 annot-version=v4.1
MFDFWWHDFNAHLWRSLPLTLHPKSVSLLDTPPQLYKVANLFITFHLSPQALPVLITKMPRKLTFLMMVLFLLSSGAKSRSISASTRAESTPPETSSHIP
AGSSPGESSINDEGYSCSGSESEEECLIRRSMADHTDYIYTQDISGP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G135150
[exp]
0 1
Potri.001G290300
[exp]
3.46 0.9180
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Potri.016G073900
[exp]
3.60 0.9326 CTS2.13
AT1G63410 Protein of unknown function (D... Potri.001G106400
[exp]
7.93 0.9170
AT1G20180 Protein of unknown function (D... Potri.002G067300
[exp]
9.00 0.8105
AT5G14020 Endosomal targeting BRO1-like ... Potri.001G323600
[exp]
10.58 0.8895
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Potri.001G161200
[exp]
12.96 0.8876
AT4G35160 O-methyltransferase family pro... Potri.011G059600
[exp]
14.69 0.8911 FOMT8,OOMT2.20
AT3G07620 Exostosin family protein (.1) Potri.014G170900
[exp]
14.83 0.8778
Potri.017G102200
[exp]
15.32 0.9033
AT1G29520 AWPM-19-like family protein (.... Potri.001G354500
[exp]
19.67 0.8779

Potri.010G135150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.