Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139400 [exp] 78 / 3e-18 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 76 / 2e-17 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.019G071200 [exp] 72 / 5e-16 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 71 / 8e-16 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 70 / 2e-15 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 67 / 2e-14 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 65 / 1e-13 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.017G000600 [exp] 62 / 2e-12 AT1G17060 166 / 1e-46 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036822 [exp] 65 / 1e-13 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017775 [exp] 64 / 3e-13 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10036942 [exp] 63 / 6e-13 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 62 / 2e-12 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10036817 [exp] 59 / 2e-11 AT2G26710 382 / 3e-121 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036820 [exp] 59 / 2e-11 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10006245 [exp] 58 / 5e-11 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036816 [exp] 57 / 5e-11 AT3G14620 339 / 8e-111 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019175 [exp] 56 / 1e-10 AT3G14620 318 / 1e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019177 [exp] 56 / 2e-10 AT2G26710 373 / 4e-124 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G139550.1 pacid=42798662 polypeptide=Potri.010G139550.1.p locus=Potri.010G139550 ID=Potri.010G139550.1.v4.1 annot-version=v4.1 ATGAACCAAGTATGGTGGACTCCAATCTGCATAAATTCTAGCTTGCATGCGCAAGGAGTAAGAGGCCCTTCTTACAGATTCCTTCAGGAAACGATTCCAA AATTGATTTCGAGTGTGGAGGTGAAGCTTGAAAGACGGAAAAATCATGACGATAGGGAGATTGCGGTATTCCAGGACTTTAAAGTTTTGACATCGGAAAT AATTTCCAGGACAGCTTTTGGATGCAGAAACCTTTATGAAATAAGAATTCCTGGAATCAGAAAATACTTTAAGACACGATGA
AA sequence Show only first row Show all	>Potri.010G139550.1 pacid=42798662 polypeptide=Potri.010G139550.1.p locus=Potri.010G139550 ID=Potri.010G139550.1.v4.1 annot-version=v4.1 MNQVWWTPICINSSLHAQGVRGPSYRFLQETIPKLISSVEVKLERRKNHDDREIAVFQDFKVLTSEIISRTAFGCRNLYEIRIPGIRKYFKTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.010G139550 [exp]	0	1
AT5G37290			ARM repeat superfamily protein...		Potri.001G225300 [exp]	3.46	0.8872
AT4G32750			unknown protein		Potri.006G241200 [exp]	4.00	0.8489
AT5G19180		ECR1	E1 C-terminal related 1 (.1)		Potri.010G031900 [exp]	5.47	0.8270	ECR1.2
AT1G50440			RING/FYVE/PHD zinc finger supe...		Potri.008G005800 [exp]	6.48	0.8311
AT4G10925			Nuclear transport factor 2 (NT...		Potri.001G089600 [exp]	10.24	0.8024
AT5G57230			Thioredoxin superfamily protei...		Potri.018G143500 [exp]	10.53	0.8012
AT5G24490			30S ribosomal protein, putativ...		Potri.012G026375 [exp]	10.95	0.8648
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Potri.003G130301 [exp]	12.00	0.8250
AT1G76440			HSP20-like chaperones superfam...		Potri.001G243100 [exp]	12.72	0.7546
					Potri.001G371000 [exp]	16.91	0.8386

Compare expression of checked genes

Potri.010G139550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.