Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47480 63 / 2e-14 Protein of unknown function (DUF3511) (.1) AT5G11970 54 / 6e-11 Protein of unknown function (DUF3511) (.1) AT3G62640 53 / 2e-10 Protein of unknown function (DUF3511) (.1) AT2G19460 47 / 2e-08 Protein of unknown function (DUF3511) (.1) AT3G05725 44 / 6e-07 Protein of unknown function (DUF3511) (.1) AT4G09890 42 / 2e-06 Protein of unknown function (DUF3511) (.1) AT3G13910 40 / 1e-05 Protein of unknown function (DUF3511) (.1) AT1G72720 36 / 0.0005 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G043600 [exp] 55 / 3e-11 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 52 / 1e-10 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 52 / 2e-10 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 51 / 7e-10 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.013G010600 [exp] 48 / 6e-09 AT2G47480 54 / 5e-11 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 48 / 1e-08 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 47 / 4e-08 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 44 / 3e-07 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.007G077500 [exp] 43 / 6e-07 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011939 [exp] 52 / 3e-10 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 52 / 3e-10 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 51 / 4e-10 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10028734 [exp] 50 / 1e-09 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10008471 [exp] 50 / 2e-09 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1) Lus10006019 [exp] 50 / 2e-09 AT2G19460 88 / 9e-24 Protein of unknown function (DUF3511) (.1) Lus10021581 [exp] 50 / 3e-09 AT5G11970 97 / 4e-27 Protein of unknown function (DUF3511) (.1) Lus10017155 [exp] 50 / 3e-09 AT5G11970 93 / 1e-25 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 49 / 5e-09 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10010929 [exp] 47 / 2e-08 AT3G05725 71 / 3e-17 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [poplar] [flax] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Potri.010G140800.2 pacid=42799543 polypeptide=Potri.010G140800.2.p locus=Potri.010G140800 ID=Potri.010G140800.2.v4.1 annot-version=v4.1 ATGCTATCATCCTCACCAATGCCACCAGTACTATCTTCATGGAATGTTCATAGCGATCATAGCATATATAAATCAAAACGGAGTTTCAACGACTCGGCTG AAGCCAAGAGACAAAAGAGAGTTATGAAGTATAAGGCCTATGCTGTTGAAGGGAAAATGAAGACCTCTTTCAGGAATGGGATACGTTGGGTCAAGGACAA GTATTGTTCACTTGTGCATAGATATTGA
AA sequence Show only first row Show all	>Potri.010G140800.2 pacid=42799543 polypeptide=Potri.010G140800.2.p locus=Potri.010G140800 ID=Potri.010G140800.2.v4.1 annot-version=v4.1 MLSSSPMPPVLSSWNVHSDHSIYKSKRSFNDSAEAKRQKRVMKYKAYAVEGKMKTSFRNGIRWVKDKYCSLVHRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47480			Protein of unknown function (D...		Potri.010G140800 [exp]	0	1
AT4G30420			nodulin MtN21 /EamA-like trans...		Potri.006G177700 [exp]	2.44	0.8901
AT5G41761			unknown protein		Potri.002G167900 [exp]	3.46	0.8843
AT1G47980			unknown protein		Potri.008G102000 [exp]	4.89	0.8540
AT4G36600			Late embryogenesis abundant (L...		Potri.005G122400 [exp]	4.89	0.8075
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Potri.001G174500 [exp]	5.00	0.8652
					Potri.001G433100 [exp]	5.19	0.7567
AT5G07330			unknown protein		Potri.015G109100 [exp]	9.64	0.7538
AT2G31090			unknown protein		Potri.019G090500 [exp]	11.48	0.7756
AT4G16130		ATISA1, ARA1	arabinose kinase (.1)		Potri.018G138202 [exp]	11.95	0.8100
AT4G22290			Ubiquitin-specific protease fa...		Potri.002G176200 [exp]	14.38	0.8322

Compare expression of checked genes

Potri.010G140800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.