Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56430 76 / 4e-17 ATNAS4 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 4, nicotianamine synthase 4 (.1) AT1G09240 74 / 2e-16 ATNAS3 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 3, nicotianamine synthase 3 (.1) AT5G04950 72 / 1e-15 ATNAS1 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 1, nicotianamine synthase 1 (.1) AT5G56080 64 / 1e-12 ATNAS2 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 2, nicotianamine synthase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G143100 [exp] 109 / 4e-30 AT1G09240 362 / 2e-126 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 3, nicotianamine synthase 3 (.1) Potri.005G014300 [exp] 77 / 1e-17 AT1G09240 405 / 8e-143 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 3, nicotianamine synthase 3 (.1) Potri.004G193400 [exp] 64 / 5e-13 AT5G04950 280 / 6e-94 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 1, nicotianamine synthase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029843 [exp] 75 / 9e-17 AT1G56430 364 / 2e-126 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 4, nicotianamine synthase 4 (.1) Lus10020696 [exp] 73 / 4e-16 AT1G56430 364 / 4e-126 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 4, nicotianamine synthase 4 (.1) Lus10031416 [exp] 61 / 1e-11 AT1G56430 340 / 2e-117 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 4, nicotianamine synthase 4 (.1) Lus10010917 [exp] 61 / 1e-11 AT1G56430 334 / 5e-115 ARABIDOPSIS THALIANA NICOTIANAMINE SYNTHASE 4, nicotianamine synthase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF03059 [poplar] [flax] NAS Nicotianamine synthase protein
Representative CDS sequence Show only first row Show all	>Potri.010G143133.1 pacid=42797442 polypeptide=Potri.010G143133.1.p locus=Potri.010G143133 ID=Potri.010G143133.1.v4.1 annot-version=v4.1 ATGCCAAATTATGAATGGCCATTACCACAAAGGAGATACTACAACTTAAAGACAAGCATGTCTCTCTCAATCTTTCTTATATTAAGCCTCCTTTGGAGGC TTGAAGGTTATCTCTTGGCTTACTGGGATGTGGCTATTGCAAAACAGGTTTCTCATACTAGTGTTCCCATGGGTCGGCAACAAGAGCTCATGATAGAAAA GGTTTGTGAGATCTCTGACAAAATCTCAAGGTTAGAGAACCTCAGTCTTTCCAAGCAGGTTGACTCACTCTTCTCCCAACTTGTAATCACATGTACAAAC CAGTGCCATATTGAAATGACCAAATTGAGTGAAGGAGTTCAAGAAATTAGAAGTAATCTAGTTAAACTTTGTGGGACAGCTGAGGGGGATCTTGGAAAGC CATTTCTCTAA
AA sequence Show only first row Show all	>Potri.010G143133.1 pacid=42797442 polypeptide=Potri.010G143133.1.p locus=Potri.010G143133 ID=Potri.010G143133.1.v4.1 annot-version=v4.1 MPNYEWPLPQRRYYNLKTSMSLSIFLILSLLWRLEGYLLAYWDVAIAKQVSHTSVPMGRQQELMIEKVCEISDKISRLENLSLSKQVDSLFSQLVITCTN QCHIEMTKLSEGVQEIRSNLVKLCGTAEGDLGKPFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56430		ATNAS4	ARABIDOPSIS THALIANA NICOTIANA...		Potri.010G143133 [exp]	0	1
					Potri.005G189000 [exp]	5.47	0.9390
AT3G61460		BRH1	brassinosteroid-responsive RIN...		Potri.001G450700 [exp]	5.91	0.9158
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.005G185000 [exp]	6.00	0.9354
AT1G08440			Aluminium activated malate tra...		Potri.001G217400 [exp]	9.48	0.8884
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Potri.009G145000 [exp]	11.22	0.8147
AT1G08440			Aluminium activated malate tra...		Potri.001G217300 [exp]	14.38	0.9044
					Potri.002G177700 [exp]	14.49	0.9016
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.016G118500 [exp]	16.73	0.9071
					Potri.009G034951 [exp]	17.54	0.8742
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.006G007000 [exp]	19.36	0.7498

Compare expression of checked genes

Potri.010G143133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.