Potri.010G144000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06660 40 / 0.0003 PAPA-1-like family protein / zinc finger (HIT type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G106200 216 / 1e-69 AT3G06660 204 / 4e-61 PAPA-1-like family protein / zinc finger (HIT type) family protein (.1)
Potri.013G008300 56 / 2e-09 AT2G47350 268 / 3e-83 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Potri.005G014000 50 / 1e-07 AT1G56460 250 / 1e-76 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Potri.002G195132 46 / 3e-06 AT1G56460 236 / 5e-74 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Potri.014G119600 41 / 0.0001 AT2G47350 272 / 1e-84 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031419 51 / 7e-08 AT1G56460 349 / 9e-115 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Lus10010914 45 / 8e-06 AT1G56460 356 / 3e-117 HIT zinc finger ;PAPA-1-like conserved region (.1.2)
Lus10016899 42 / 0.0001 AT3G06660 214 / 1e-64 PAPA-1-like family protein / zinc finger (HIT type) family protein (.1)
PFAM info
Representative CDS sequence
>Potri.010G144000.1 pacid=42798793 polypeptide=Potri.010G144000.1.p locus=Potri.010G144000 ID=Potri.010G144000.1.v4.1 annot-version=v4.1
ATGTCTGGTGAAAGTGCTGATGTGAACAGAACATTCCATTTTGAAGCAGTTCGAAAGAGTAATCAAGTTCCTAAGAGGCGTGCAATGGATGTGGAATTTG
ATGAAGATGATAACATAGACGAGGAAGTACCTTACCTTGGAAGACTCAGTGCTTATAAGGAGAGAAAAAGAGAGATATCAATGGTTTCAGATGATAGGCA
AGAGGATAAGGATTATGTGCAAGAAGAAGAACCAACATCAGTTGATGAACCTAGATACACAATCAAGAAGCTGGGATTCGTTGGAGGAAGGAATGAATCA
ACTACAATAACACATAATCAGGCTCTTCAGACAGCCAAAGATGATTTTCTTGTTCCTGGCACCAGTCTTCTTGAGTTCTCAAATGGTTTACCTTCACCCC
CTCCTAAAAGGGAGTGTTTCTCTGTCTCTATGTTCTTTGGATCAGTCTCATTTTACATCTTGGATAGGGAATGA
AA sequence
>Potri.010G144000.1 pacid=42798793 polypeptide=Potri.010G144000.1.p locus=Potri.010G144000 ID=Potri.010G144000.1.v4.1 annot-version=v4.1
MSGESADVNRTFHFEAVRKSNQVPKRRAMDVEFDEDDNIDEEVPYLGRLSAYKERKREISMVSDDRQEDKDYVQEEEPTSVDEPRYTIKKLGFVGGRNES
TTITHNQALQTAKDDFLVPGTSLLEFSNGLPSPPPKRECFSVSMFFGSVSFYILDRE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G144000 0 1
AT3G54800 Pleckstrin homology (PH) and l... Potri.008G038800 6.63 0.7212
AT5G53588 CPuORF50 conserved peptide upstream ope... Potri.015G006850 11.00 0.6465
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.001G012300 15.65 0.6753
AT4G24580 REN1 ROP1 ENHANCER 1, Rho GTPase ac... Potri.005G157400 22.62 0.6807
AT1G22060 unknown protein Potri.005G170066 22.84 0.7033
AT5G60690 HD IFL1, REV REVOLUTA, INTERFASCICULAR FIBE... Potri.009G014500 23.62 0.6615 Pt-HB1.8
AT4G33440 Pectin lyase-like superfamily ... Potri.007G105800 57.72 0.5892
AT5G42690 Protein of unknown function, D... Potri.002G128400 62.96 0.5815
AT1G76620 Protein of unknown function, D... Potri.002G001900 76.55 0.6335
AT1G26810 GALT1 galactosyltransferase1 (.1) Potri.008G086900 80.21 0.6084

Potri.010G144000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.