Potri.010G144600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06320 36 / 0.001 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016903 37 / 0.0009 ND 36 / 0.006
PFAM info
Representative CDS sequence
>Potri.010G144600.2 pacid=42797356 polypeptide=Potri.010G144600.2.p locus=Potri.010G144600 ID=Potri.010G144600.2.v4.1 annot-version=v4.1
ATGCATGGATTCAGAAGAACACACAAGCGCTCCAAGCGATCGACACTGGAAGACAATTTCTTACCGTACGATGACGCATCACTCTCGCTCGGTGAAGCGA
AACAAGACTTGGAATCTATGAAATGGCAGGAGTGTTCAGACCAATCTATCGAGACCGTGCTTTTCAATCACAAAACTAATGATGAAGTCAAATCCAACGG
TCATGACGATGCTTTGAAGAGTTTTGTGCGGTCGTCGCAAGAAGGGGAGAAGATCTAG
AA sequence
>Potri.010G144600.2 pacid=42797356 polypeptide=Potri.010G144600.2.p locus=Potri.010G144600 ID=Potri.010G144600.2.v4.1 annot-version=v4.1
MHGFRRTHKRSKRSTLEDNFLPYDDASLSLGEAKQDLESMKWQECSDQSIETVLFNHKTNDEVKSNGHDDALKSFVRSSQEGEKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G144600 0 1
AT4G38660 Pathogenesis-related thaumatin... Potri.005G112600 1.00 0.9182
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.014G006900 1.41 0.9075 Pt-PSK3.2
AT1G73670 ATMPK15 MAP kinase 15 (.1) Potri.010G112200 5.29 0.8775
AT1G69040 ACR4 ACT domain repeat 4 (.1.2) Potri.001G060100 6.00 0.8739
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Potri.007G006800 6.24 0.8982 Pt-PSK3.1
AT5G25830 GATA GATA12 GATA transcription factor 12 (... Potri.013G059600 7.74 0.8527
AT3G02380 CO ATCOL2, COL2 CONSTANS-like 2 (.1) Potri.017G107500 9.16 0.8847
AT2G41310 ARR8, ATRR3 RESPONSE REGULATOR 8, response... Potri.016G038000 9.79 0.8692
AT5G10290 leucine-rich repeat transmembr... Potri.007G094500 12.24 0.8204
AT3G09600 MYB LCL5 (LHY-CCA1-... REVEILLE 8, LHY-CCA1-LIKE5, Ho... Potri.016G083900 16.43 0.8846

Potri.010G144600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.