Plant FIBer expression Database

Pt-RTM1.1 (Potri.010G144900) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RTM1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05760 92 / 6e-24 RTM1 restricted tev movement 1, Mannose-binding lectin superfamily protein (.1)
AT1G05770 74 / 1e-16 Mannose-binding lectin superfamily protein (.1)
AT2G43730 67 / 8e-14 Mannose-binding lectin superfamily protein (.1)
AT2G43740 63 / 3e-12 Mannose-binding lectin superfamily protein (.1.2)
AT5G28520 49 / 3e-07 Mannose-binding lectin superfamily protein (.1)
AT1G19715 48 / 8e-07 Mannose-binding lectin superfamily protein (.1.2.3)
AT1G61230 48 / 8e-07 Mannose-binding lectin superfamily protein (.1)
AT3G16460 45 / 1e-05 JAL34 jacalin-related lectin 34, Mannose-binding lectin superfamily protein (.1.2)
AT1G73040 43 / 2e-05 Mannose-binding lectin superfamily protein (.1)
AT1G52110 43 / 5e-05 Mannose-binding lectin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G232400
[exp]
63 / 5e-12 AT1G19715 609 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Potri.002G030400
[exp]
59 / 8e-11 AT1G19715 590 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Potri.017G010900
[exp]
49 / 3e-07 AT3G16460 135 / 5e-34 jacalin-related lectin 34, Mannose-binding lectin superfamily protein (.1.2)
Potri.012G140001
[exp]
47 / 6e-07 AT1G73040 214 / 1e-71 Mannose-binding lectin superfamily protein (.1)
Potri.005G232500
[exp]
47 / 2e-06 AT1G19715 486 / 2e-166 Mannose-binding lectin superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024290
[exp]
58 / 4e-10 AT1G19715 607 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Lus10024291
[exp]
54 / 1e-08 AT1G19715 438 / 1e-146 Mannose-binding lectin superfamily protein (.1.2.3)
Lus10006866
[exp]
43 / 6e-05 AT1G73040 194 / 5e-58 Mannose-binding lectin superfamily protein (.1)
Lus10037605
[exp]
40 / 0.0003 AT1G73040 198 / 1e-62 Mannose-binding lectin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0568 Man_lectin PF01419 Jacalin Jacalin-like lectin domain
Representative CDS sequence
>Potri.010G144900.2 pacid=42797373 polypeptide=Potri.010G144900.2.p locus=Potri.010G144900 ID=Potri.010G144900.2.v4.1 annot-version=v4.1
ATGATCAAGTTAGAGGCTGGAACAAAACGCCTAGTACCTATCTGGGGTCACTCTGAAATCTCCAACCTAGAATTTGACTGGGATCATAATGGGAGCACTG
AAATCTCCCACATCTATATTTCTCACGATAATCATATCCGTTTTATTCAATTTCAGTATGTTGAAGAGAATGGAGTCCTGTCCAAGCTTTCTCCGATGCC
CGTTAAGAATCCTTATGGTTGGAGATTCAATGTTGTTAAGCTTGATTATCCGCGTGAGTTTCTCAAGGGGATTAGTGGCGATTGGAGTCATGGAAATGTG
AACTCATTGACATTTACTACGAACCGTGGGACCTATGGTCCTTTCGGTTGCAAGGCAGAAAATGGTACTGAATTCGATTTTCAAACAGGAGATGAGCCTC
TATTTGCTGGATTGCATGGATCCTTTGATGACGCCGGTCTTAGAACAATAGGAATCTATGTGAATCCAGAACAAGCCAGTTTCTGA
AA sequence
>Potri.010G144900.2 pacid=42797373 polypeptide=Potri.010G144900.2.p locus=Potri.010G144900 ID=Potri.010G144900.2.v4.1 annot-version=v4.1
MIKLEAGTKRLVPIWGHSEISNLEFDWDHNGSTEISHIYISHDNHIRFIQFQYVEENGVLSKLSPMPVKNPYGWRFNVVKLDYPREFLKGISGDWSHGNV
NSLTFTTNRGTYGPFGCKAENGTEFDFQTGDEPLFAGLHGSFDDAGLRTIGIYVNPEQASF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05760 RTM1 restricted tev movement 1, Man... Potri.010G144900
[exp]
0 1 Pt-RTM1.1
AT2G47480 Protein of unknown function (D... Potri.014G123600
[exp]
2.44 0.8117
AT5G13190 AtGILP GSH-induced LITAF domain prote... Potri.001G061900
[exp]
2.82 0.8515
Potri.019G108500
[exp]
3.31 0.8564
AT2G42610 LSH10 LIGHT SENSITIVE HYPOCOTYLS 10,... Potri.011G109900
[exp]
5.74 0.8059
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G116210
[exp]
5.74 0.8388
AT5G45540 Protein of unknown function (D... Potri.015G114101
[exp]
9.79 0.8301
AT4G36750 Quinone reductase family prote... Potri.004G151100
[exp]
9.79 0.8103
AT2G44930 Plant protein of unknown funct... Potri.017G019700
[exp]
10.81 0.8032
AT2G26520 unknown protein Potri.009G106300
[exp]
11.83 0.8076
Potri.019G108700
[exp]
15.65 0.8203

Potri.010G144900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.